Conserved Protein Domain Family
PHA02054

?
PHA02054: PHA02054 
hypothetical protein
Statistics
?
PSSM-Id: 177337
View PSSM: PHA02054
Aligned: 3 rows
Threshold Bit Score: 182.518
Threshold Setting Gi: 109290069
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
37651571    1 MPKIIAAVALLVATVHLVSANPEVGSYDEFMQGAM-IVYTNDITHSKDNSVQFLEYLDTKWGSAGCSDTCFQLGYQEAKL 79 
66391893    1 MPKIIAAVALLVATVHLVSANPEVGSYDEFMQGAM-IVYTNDIKHSKDNSVQFLEYLDTKWGSTGCSDTCFQLGYQEAKL 79 
109290069  41 MLKTFSIIALVLASMHFVEADPESGSYDEYMRGALnIVYSNEIVPSLDNSVEFLEHLNDKWKSVKCSSSCYQTGYLEAKT 120
37651571   80 FVAYNTEVQNGNKIQ 94 
66391893   80 FVAYNTEVQNGNKIQ 94 
109290069 121 FITKREG--HGSKIR 133
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap