Conserved Protein Domain Family
PHA02053

?
PHA02053: PHA02053 
hypothetical protein
Statistics
?
PSSM-Id: 177336
View PSSM: PHA02053
Aligned: 6 rows
Threshold Bit Score: 203.257
Threshold Setting Gi: 157311383
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66391616    1 MTEILDELMYAYRERCNNGRITEPKAKAIIERYWSKLREQDASSKllnsLMVLKLLIASGDDMPCDTNSAEEFQKAYRSW 80 
33620659    2 QNDVIEIIMNQYRNRIWSGRIKEEKAKRIIEKYAEKTKQAPTANR----VMILKCLVLSGDDMPIDAETATDFHKTYRQC 77 
157311383   2 QNDVIEIIMNQYRNRIWSGRIKEEKAKRIIEKYAEKTKQAPTANR----VMILKCLVLSGDDMPIDAKTATDFHKTYRQC 77 
238694963   2 QNDVIEIIMNQYRNRIWSGRIKEEKAKRIIEKYAEKTKQAPTANR----VMILKCLVLSGDDMPIDAETATDFHKTYRQC 77 
294661555   1 MQEIIDELMYVYRERCEKARITEPKVKAIIENYCSKIQAQDPSAKllnsLMILKLLIASGDDMPYDATNAAEFQKAYRSW 80 
304373708   1 MTEILDELMYVYRERCSNGRITEPKAKAIIERYWSKLREQDASSKllnsLMVFKLLIASGDDMPCDTNSAEEFQKAYRSW 80 
66391616   81 GVIYSRSLGSYDSVMWNLMHMDKLIWEVLEEEGIV 115
33620659   78 DVIFTSGFGSYDSIMWNLMHLDSTIWDVLSEEGYK 112
157311383  78 DVIFTSGFGSYDSIMWNLMHLDATIWDVLSEEGYK 112
238694963  78 DVIFTSGFGSYDSIMWNLMHLDSTIWDVLSEEGYK 112
294661555  81 GVIYSRSLGSHDSVMWNLMHMDKLIWEVLKEEGIE 115
304373708  81 GVIYSRSLGSYDSVMWNLMHLDKLIWEVLKEEGIV 115
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap