Conserved Protein Domain Family
PHA02004

?
PHA02004: PHA02004 
capsid protein
Statistics
?
PSSM-Id: 177331
View PSSM: PHA02004
Aligned: 10 rows
Threshold Bit Score: 584.517
Threshold Setting Gi: 282554619
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
158345177   3 YPAANTHTRPGWGGANSDVSLHIEEHLGLVDASFMYSSKFASWMNVRSLRG-TNQLRVDRVGASTIAGRKAGEELVVQKN 81 
158345059   1 MSFLNDLTRPNYAGKNADVDIHLEEHLGIVDKHFAYTSKFAPLMNIRDLRG-SNVVRLDRLGNVEAKGRRAGEELERSRV 79 
33300843    1 MSFLNDLTRPNYAGKNADVDIHLEEHLGIVDKHFAYTSKFAPLMNIRDLRG-SNVVRLDRLGNVEAKGRRAGEELERSRV 79 
167600478   1 MSFLNDLTRPNYAGKNADVDIHLEEHLGIVDKHFAYTSKFAPLMNIRDLRG-SNVVRLDRLGNVEAKGRRAGEELERSRV 79 
195546739   1 MSFLNDLTRPNYAGKNADVDIHLEEHLGIVDKHFAYTSKFAPLMNIRDLRG-SNVVRLDRLGNVEAKGRRAGEELERSRV 79 
195546677   1 MSFLNDLTRPNYAGKNADVDIHLEEHLGIVDKHFAYTSKFAPLMNIRDLRG-SNVVRLDRLGNVEAKGRRAGEELERSRV 79 
225626359   1 MSFLNDLTRPNYAGKNADVDIHLEEHLGIVDKHFAYTSKFAPLMNIRDLRG-SNVVRLDRLGNVQVKGRRAGEELERSRV 79 
229604953   4 TSYKPGLTRPHWGGAASDEDIHLEVYQNEVDTRFQYAAMFRGLSAQRSTAErSNTYRIDRLNTSTVKGRRSGEALDNTPV 83 
282554619   4 TIYKSALTRAHWGGAASDVDIHLEVYQNEVDTRFQYQALFLGLSSQRSISG-SNTYRIDRLNTSSVKGRRSGEALDSTPV 82 
281306689   1 MTVLADLTRPQWAGPDADVDIHIEEHLGIVDKSFGYSSQLASVMNIRQLRG-TNTARIDRVGAVKIGGRKTGEKLVSSRV 79 
158345177  82 VSDKLNLTVDTVLYARHFFDKFDEWTSNLDVRKETAREDGIALARQYDQACIIQLQKCGDFLAPAHLKPAFHDGILLPST 161
158345059  80 VNDKWNLTVDTLLYLRHQFDHQDEWTQSFDMRKEVAELDGQELARKFDQACLIQVIKAAAMDAPVDLEDAFSPGVLEKLD 159
33300843   80 VNDKWNLTVDTLLYLRHQFDHQDEWTQSFDMRKEVAELDGQELARKFDQACLIQVIKAAAMDAPVDLEDAFSPGVLEKLD 159
167600478  80 VNDKWNLTVDTLLYLRHQFDHQDEWTQSFDMRKEVAELDGQELARKFDQACLIQVIKAAAMDAPVDLEDAFSPGVLEKLD 159
195546739  80 VNDKWNLTVDTLLYLRHQFDHQDEWTQSFDMRKEVAELDGQELARKFDQACLIQVIKAAAMDAPVDLEDAFSPGVLEKLD 159
195546677  80 VNDKWNLTVDTLLYLRHQFDHQDEWTQSFDMRKEVAELDGQELARKFDQACLIQVIKAAAMDAPVDLEDAFSPGVLEKLD 159
225626359  80 VNDKWNLTVDTLLYLRHQFDHQDEWTQSFDMRKEVAELDGQELARKFDQACLIQVIKAAAMDAPVDLEDSFSPGVLEKLD 159
229604953  84 RNDKMIIVVDTVLYIRNPIDYQDDWTAP-DFLTEMGQNNGSEFAEVFDQAHLIQLIKGRAWDAPEHLKPAFNDGVEVLAT 162
282554619  83 RNDKMIIVVDTVLYIRNPIDYQDDWTGP-DFLTEMGQNNGSEFAETFDQAHLIQLIKGRSWVAPAHLKPAFNDGIEVGAA 161
281306689  80 VNDKFTLLVDTVLYARHEFDKFDQWTSDLDMRKETAEEDGIALAKQFDQACLIMAAKCADFVAPAGLEGAFHNGILTQAT 159
158345177 162 I---------SGLAADAAadADVLVAAHRQGVEAMVFRDLGDQLMSEGVTLLDPVIFSFLLEHDRLMNVEFGAKEGGNSF 232
158345059 160 L---------TGLTAKEA--AEKIVRMHRRVVETFIERDLGDAVYSEGLTPMSPRVFSLLLEHDKLMSVEYQATGATNDY 228
33300843  160 L---------TGLTAKQA--ADKIVRMHRRVVETFIDRDLGDAVYSEGLTPMSPRVFSLLLEHDKLMNVEYQATGATNDY 228
167600478 160 L---------TGLTAKQA--ADKIVRMHRRVVETFIDRDLGDAVYSEGLTPMSPRVFSLLLEHDKLMNVEYQATGATNDY 228
195546739 160 L---------TGLTAKQA--ADKIVRMHRRVVETFIDRDLGDAVYSEGLTPMSPRVFSLLLEHDKLMNVEYQATGATNDY 228
195546677 160 L---------TGLTAKQA--ADKIVRMHRRVVETFIDRDLGDAVYSEGLTPMSPRVFSLLLEHDKLMNVEYQATGATNDY 228
225626359 160 L---------TGVTSSKEa-ANKIVRMHRKVVESFINRDLGDAVYSEGLTPMSPRVFSLLLEHDKLMNVEYQATGATNDY 229
229604953 163 Yka------aAVTQEELEanAISINEAHKAGVTELVKRKVP---LTDQITLVSPDIYSALVEHPKLLNQEFNVD--MSDY 231
282554619 162 IlvpgatpstQLTQAEMEanAMNINLAHKAGIDELIKRKVP---LMDMVTLVDVDTYSRLLEHPKLFDRDFGDSN-MDGY 237
281306689 160 V---------TGLPGNAEadADALVRAHREGIEQLILRDLSDAVYSEGITFVDPRIFTLLLDHKKLMNVEFQALGGVNDF 230
158345177 233 VGGRIAMLNGVRVVETPRFPQSAITANALGADFNVTDAEVRRKMITFIPSMALISAQVHPVSAQFWEEKKDFGHYLDTFQ 312
158345059 229 VKSRVAILNGVKVLETPRFATKAISAHPLGRHFNVSAEEAERQIALFLPSKTLITAQVAPVQAKLWEDHDQFSWVLDTFQ 308
33300843  229 VKSRVAILNGVKVLETPRFATKAIAAHPLGRHFNVSAEESERQIALFLPSKTLITAQVAPVQAKLWEDNEKFSWVLDTFQ 308
167600478 229 VKSRVAILNGVKVLETPRFATKAIAAHPLGRHFNVSAEESERQIALFLPSKTLITAQVAPVQAKLWEDNEKFSWVLDTFQ 308
195546739 229 VKSRVAILNGVKVLETPRFATKAIAAHPLGRHFNVSAEESERQIALFLPSKTLITAQVAPVQAKLWEDNEKFSWVLDTFQ 308
195546677 229 VKSRVAILNGVKVLETPRFATKAIAAHPLGRHFNVSAEESERQIALFLPSKTLITAQVAPVQAKLWEDNEKFSWVLDTFQ 308
225626359 230 VKSRVAILNGVKVLETPRFATEAIAAHPLGRHFNVSAEEAERQIALFLPSKTLITAQVAPVQAKLWEDHDQFSWVLDTFQ 309
229604953 232 GGRRVVRMNGVPVVECTEFPTGAIAAHPLGTSFNVSAEDAKCQMVTFSKSRTLVTVEAHPFTTRIWDDEKEFCNVLDCYA 311
282554619 238 KQRRAVVMNGIPVVECTEFPT-VAGTHPLGSAYTVTSDDALCRMVTFSKSKTLVTVEAKPFTSRIWDDEREFSNVLDCYA 316
281306689 231 ARSRIAVLNGVRLVETPRVVTEVITDNPLGDAFNVTAEEAKRRMITIIPSKTLVSAQVHAITGDYWEDKREFCWVLDTYQ 310
158345177 313 SYNIGQRRPDAVAVHDITVTNP 334
158345059 309 MYNIGARRPDTAGAIELKGIEA 330
33300843  309 MYNIGARRPDTAGAIELKGIGA 330
167600478 309 MYNIGARRPDTAGAIELKGIGA 330
195546739 309 MYNIGARRPDTAGAIELKGIGA 330
195546677 309 MYNIGARRPDTAGAIELKGIGA 330
225626359 310 MYNIGARRPDTAGAIELKGINA 331
229604953 312 MYTVGQRRPDTAIVTKFEEPA- 332
282554619 317 MYNIGLRRPDTAAVTKFTFTTK 338
281306689 311 SYNIAQRRADAAAIVEVTGL-- 330
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap