Conserved Protein Domain Family
PHA01976

?
PHA01976: PHA01976 
helix-turn-helix protein
Statistics
?
PSSM-Id: 177330
View PSSM: PHA01976
Aligned: 3 rows
Threshold Bit Score: 110.431
Threshold Setting Gi: 149882963
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
72257076   3 DEFPMRIIRLRRHRNMTVNQFAKYLGVGNKQVYTWEYGDSLPSFDMLYRIHTLTGVSLDWLVAGCGT 69 
38638670   1 MSFAIQLIKARNARAWSAPELSRRAGVRHSLIYDFEADKRLPNLKTLLRLADALGVTLDWLCGRSSE 67 
149882963  1 MSFAIQLIKARNARAWSAPELSRRAGVRHSLIYDFEADKRLPNLKTLLRLADALGVTLDWLCGRTPE 67 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap