Conserved Protein Domain Family
PHA01929

?
PHA01929: PHA01929 
putative scaffolding protein
Statistics
?
PSSM-Id: 177328
View PSSM: PHA01929
Aligned: 8 rows
Threshold Bit Score: 314.686
Threshold Setting Gi: 281306688
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
158345058   1 MQPNEQQLPPGLANLVANVP------PAAAPTPNgghvqvmPNPVIqpqpQPQYVSQPGQPGSPQQLAIPTQQPQPVPTS 74 
33300842    2 TQPNEQQLPPGLANLVANIP------PAAAPTPNhvq--vmPNPVI----QQQAPVQPGQVGAPQQLAIPTQQPQPVPTS 69 
167600477   2 TQQNEQQLPPGLANLVANVP------PAAAPTPShvq--vmPNPVI----QPQAPVQPGQVGAPQQLAIPTQQPQPVPTS 69 
195546676   2 TQPNEQQLPPGLANLVANIP------PAAAPTPNhvq--vmPNPVI----QQQAPVQPGQVGAPQQLAIPTQQPQPVPTS 69 
195546738   2 SQPNEQQLPPGLANLIANVP------PAAAPTPShvq--vmPNPVI----QPQAPVQPGQVGAPQQLAIPTQQPQPVPTS 69 
225626358   1 MQQNEQQLPPGLANLVANVP------PAAAPTPShvq--vmPNPVIq--pQPQYAAQPGQAGSPQQLAIPTQQPQPVPTS 70 
281306688   1 MTTNNQNLPAGLAGRAAQASaaapqaPAPAPAPA-------PAPVAvpepAASQPFTSLQPQDPAFNANPAPAPAPAPVN 73 
282554617  12 TTQVENQGGPKIPGLDA---------PLNAPNNQ----------------------------GVQDAQTPTQQ------- 47 
158345058  75 AMTPHyqpvavpvagqpVVPQAPAQPTPVAPPAPGVVLPENLEVPPPPAFIPN----GEIVGTLAGNLEGDPQLAPSISY 150
33300842   70 AMTPHyqpvavpaagqpVVPQAPAQPAPVAPPAAGAVLPENLEVPPPPAFTPN----GEIVGTLAGNLEGDPQLAPSISY 145
167600477  70 AMTPHyqpvaapavgqpVVPQAPAQPAPVAPPAAGAVLPENLEVPPPPAFTPN----GEIVGTLAGNLEGDPQLAPSISY 145
195546676  70 AMTPHyqpvavpaagqpVVPQAPAQPAPVAPPAAGAVLPENLEVPPPPAFTPN----GEIVGTLAGNLEGDPQLAPSISY 145
195546738  70 AMTPHyqpvavpvagqpVVPQAPAQPAPVAPPAAGAVLPENLEVPPPPAFTPN----GEIVGTLAGNLEGDPQLAPSISY 145
225626358  71 AMTPHyqpvavpaagqpVVPQAPAQPAPVAPPAPGAVPPENLEVPPPPAFTPN----GEIVGTLAGNLEGDPQLAPSISY 146
281306688  74 PMLSH------------VSQNAPAEPAPAAAPPAAPAVPDALKPVALPTDKPAeaapEASVAHLAGVFAQDVNLAPAVGY 141
282554617  48 -------------------QQGKDSPDPAKIPLDIEALKAALDKGGDSAKEQP----QELAKT------GNPTIDAGVAM 98 
158345058 151 LEAFT--DKLDTVRAFGKAAEHRDPRFIDEHYLKEVLGEAQAQHVINVAKGVLTYVDAQTKAVLNQTYAAVGGEAVLKQA 228
33300842  146 LEAFS--DKLDTVRAFGKAAENRDPRFIDEHYLKEVLGPAQAQHVINVAKGVLTYVDAQTKAVLNQTYAAVGGEAVLKQA 223
167600477 146 LEAFS--DKLDTVRAFGKAAENRDPRFIDEHYLKEVLGPAQAQHVINVAKGVLTYVDAQTKAVLSQTYAAVGGEAILKQA 223
195546676 146 LEAFS--DKLDTVRAFGKAAENRDPRFIDEHYLKEVLGPAQAQHVINVAKGVLTYVDAQTKAVLNQTYAAVGGEAVLKQA 223
195546738 146 LEAFS--DKLDTVRAFGKAAENRDPRFIDEHYLKEVLGPAQAQRVINVAKGVLTYVDAQTKAVLNQTYAAVGGEAVLKQA 223
225626358 147 LEAFT--DKIDTVRAFGKAAEHRDPRFIDEHYLKEALGEAQAQHVINVAKGVLTYVDAQTQAVLNQTYAAVGGEALLKQA 224
281306688 142 LDSFCtdNGLDVARVFGKAAEEGDARFIDTGYLTEKLGKEAADKLVKVGSDVIAYINAYTDQSVAEVHKAAGGEAQWDHA 221
282554617  99 LQKVSglTDSDMVRALGKALEYQDPNLIDTAFIRERFGE-HAAYAELLAKAYLEDQVGQATKAVQEAYDIVGGKENWEVA 177
158345058 229 ASVFDQHADPATKAAIGRLMDSGDAQSMQYAAKQIIAFAQGSGAVVQAAGQPLGAAAPAMLALSAEQYRAEVSKLPLNAS 308
33300842  224 AGVFNQHADPATKAAIGRLMDSGDAQAMQYAAKQIIAFAQGSGAVVQAAGQPLGAAAPALAALSAEQYRAEVSKLPLNAS 303
167600477 224 AGVFNQHADPATKAAIGRLMDSGDAQAMQYAAKQIVAFAQGSGAVVQATGQPLGAAAPALAALSAEQYRLEVSKLPLNAS 303
195546676 224 AGVFNQHADPATKAAIGRLMDSGDAQAMQYAAKQIIAFAQGSGAVVQAAGQPLGAAAPALAALSAEQYRAEVSKLPLNAS 303
195546738 224 AGVFNQHADPATKAAIGRLMDSGDAQAMQYAAKQIVAFAQGSGAVVQATGQPLGAAAPALAALSAEQYRLEVSKLPLNAS 303
225626358 225 ASVFNQHADPATKAAIGRLMDSGDAQSMQYAAKQIVAFAQGSGAVVKATGQPLGAAAPALAALSAEQYRAEVSKLPLNAS 304
281306688 222 AKLYSEKADPMERQIVADLLNSGDRAKMAHAAKMVTQFAVSQGGAISHNAPALGLPG-GQKGLTQAEHIANISKRGVTPE 300
282554617 178 AQLFNSKAPEPLRNAARVLANSGE---LKQAAELVAGFCRDMGLI--KTQNPMVRGVASNNALSAAEFRAEYTKLRQEAG 252
158345058 309 EADMAA---------LRERRKAGMAQGL 327
33300842  304 EADMAA---------LRERRKAGMAQGI 322
167600477 304 EAEMAA---------LRERRKAGMAQGI 322
195546676 304 EADMAA---------LRERRKAGMAQGI 322
195546738 304 EADMAA---------LRERRKAGMAQGI 322
225626358 305 EADMAA---------LRERRKAGMAQGL 323
281306688 301 QYAESV-----------KMRRLGKSQGL 317
282554617 253 NRSLASpqfsqryndLLARREAGKRVGL 280
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap