Conserved Protein Domain Family
PHA01819

?
PHA01819: PHA01819 
hypothetical protein
Statistics
?
PSSM-Id: 107089
View PSSM: PHA01819
Aligned: 4 rows
Threshold Bit Score: 88.5074
Threshold Setting Gi: 157738607
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
29565742    1 MTEFDEIVKPDDKEETSESTEENLESTEETSesteESTEESTEESTEDKTVETIEEENENKLEPTTTDEDSSKFDPVVLE 80 
66395202    1 MTEFDEIVKPDDKEETSESTEENSESTEETS----ESTEESTEESTEDKTVETIEEENENKLEPTTTDEDSSKFDPVVLE 76 
157738607   1 MTEFEEIVKPDDKEPTE------------------EPTEEPTEEPTEDKTVETIEEENKNKLEPTITDEDSSKFDPVILE 62 
29565765    1 MTEFDEIVKPDDKEETSESTEENLESTEETSesteESTEESTEESTEDKTVETIEEENENKLEPTTTDEDSSKFDPVVLE 80 
29565742   81 QRIASLEQQVTTFLSSQMQQPQQVQQTQSDVTESNKEDNDYSDEELVDKLDLD 133
66395202   77 QRIASLEQQVTTFLSSQMQQPQQVQQTQPDVTESDKEDNDYSDEELVDKLDLD 129
157738607  63 QRITSLEQQMTTFLSSQIQQP---QQTQPDVTNADKEDKDYSDEELVDKLDLD 112
29565765   81 QRIASLEQQVTTFLSSQMQQPQQVQQTQSDVTESNKEDNDYSDEELVDKLDLD 133
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap