Conserved Protein Domain Family
PHA01818

?
PHA01818: PHA01818 
hypothetical protein
Statistics
?
PSSM-Id: 107088
View PSSM: PHA01818
Aligned: 3 rows
Threshold Bit Score: 694.129
Threshold Setting Gi: 66391272
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66394966   1 MALNFTTITENNVIRDLTTQVNNIGEELTKERNIFDITDDLVYNFNKSQKIKLTDDKGLTKSYGNITALRDIKEPGYYYI 80 
48696456   1 MALNFTTITENNVIRDLTTQVNNIGEELTKERNIFDITDDLVYNFNKSQKIKLTDDKGLTKSYGNITALRDIKEPGYYYI 80 
66391272   2 ALINFKEITESDTLKALTEAVNNIGTELSEDGNIFAKVEKLETQSASTPKYYLVQDSGKAKQVSSRSSLSSITQTGFYYV 81 
66394966  81 GARTLATLLDRPDMESLDVVLHVVPLDTSSKVVQHLYTLSTNNNQIKMLYRFVSGNSSSEWQFIQGLPSNKNAVISGTNI 160
48696456  81 GARTLATLLDRPDMESLDVVLHVVPLDTSSKVVQHLYTLSTNNNQIKMLYRFVSGNSSSEWQFIQGLPSNKNAVISGTNI 160
66391272  82 SSNVSFYISELPQELRTDLLLSVYQTEVG--VVQFINTISTVESKKYFAYRVNYNGMAGSWRFIDSRINNRSTLVVGGSY 159
66394966 161 LDIASPGVYFVMGMTGGMPSGVSSGFLDLSVDANDNRLARLTDAETGKEYTSIKKPTGTYTAWKKEFEPKDMEKYLLSSI 240
48696456 161 LDIASPGVYFVMGMTGGMPSGVSSGFLDLSVDANDNRLARLTDAETGKEYTSIKKPTGTYTAWKKEFEPKDMEKYLLSSI 240
66391272 160 KDIITPGNYIVNSLK-DLPDSNSDGYLSVITNQSDER-SYIYISPDNKMYHSVSNQSKDY-EWVKEFETKDIEKYLLTNL 236
66394966 241 RDDGSASFPLLVYTSDSKTFQQAIIDHIDRTG-QTTFTFYVQGGVSGSPMSNSCRGLFMSDTPNTSSLHGVYNAIGTDGR 319
48696456 241 RDDGSASFPLLVYTSDSKTFQQAIIDHIDRTG-QTTFTFYVQGGVSGSPMSNSCRGLFMSDTPNTSSLHGVYNAIGTDGR 319
66391272 237 ----DGSFNLLIYSNEGKSFETKVLEYLNSLDkPRTFTFYIQGGVSGNPSSGSCRGLFVIDSIN----YGNYYMIDNYGN 308
66394966 320 NVTGSVVGSNWTSPKTSPSHKELWTGAQSFLSTGTTNNLSDDISNYSYVEVYTTHKTTEKTKGN--DNTGTICHKFYLDG 397
48696456 320 NVTGSVVGSNWTSPKTSPSHKELWTGAQSFLSTGTTKNLSDDISNYSYVEVYTTHKTTEKTKGN--DNTGTICHKFYLDG 397
66391272 309 LFTGSLNNGALLKAKPSTSSDVLWTGAKNFTDKGTVETLKFPIADYEYVKIFVTVPSQGPNTSDitNDLQNGAHEFYIKG 388
66394966 398 SGTYVCSGTFVSGDRTDTKPPITEFYRVGVSFKGSTWTLVDSAVQNSKTQYVTRIIGINMP 458
48696456 398 SGTYVCSGTFVSGDRTDTKPPITEFYRVGVSFKGSTWTLVDSAVQNSKTQYVTRIIGINMP 458
66391272 389 QSRASVSGLVVSSDTK------FDLYRVGIAFGQKSWRITDMAKTNTKNAYITRIVGINY- 442
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap