Conserved Protein Domain Family
PHA01816

?
PHA01816: PHA01816 
hypothetical protein
Statistics
?
PSSM-Id: 107086
View PSSM: PHA01816
Aligned: 4 rows
Threshold Bit Score: 230.715
Threshold Setting Gi: 157738594
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66395198    1 MVRHTSEMDRWKKEREARKEQEKDLFLNDFSNVNFKFDDKDLQEAYIDTWKHFAHLPYFPKERNVSYVNAVSLVRGSRHK 80 
29565751    1 MVRHTSEMDRWKKEREARKEQEKDLFLNDFSNVNFKFDDKDLQEAYIDTWKHFAHLPYFPKERNVSYVNAVSLVRGSRHK 80 
157738594   1 -------MDRWKKEREARKEREEKKYKNDFSGINFKFDDKDLQEAYIDAWKHFSHLPHLPKEKNVSHANAVSLVRGKRHK 73 
29565729    1 MVRHTSEMDRWKKEREARKEQEKDLFLNDFSNVNFKFDDKDLQEAYIDTWKHFAHLPYFPKERNVSYVNAVSLVRGSRHK 80 
66395198   81 KLNYIHEIYNRNDDSNNKNAKKHKYALYNLQAKNNNSSMYKYIKEIDTLYKEIGKSDRPVTNIDDEDVRYNFLYYATFDE 160
29565751   81 KLNYILEIYNRNDDSNNKNAKKHKYALYNLQAKNNNSSMYKYIKEIDTLYKEIGKSDRPVTNIDDEDVRYNFLYYATFDE 160
157738594  74 KLNHILEIYNRNDN-NNKNAKMHKYALYNLHAEKNKSSLTKYIKEIDNLFFEIGKSDRPKTTIDDINVRYNFLYYATFEE 152
29565729   81 KLNYILEIYNRNDDSNNKNAKKHKYALYNLQAKNNNSSMYKYIKEIDTLYKEIGKSDRPVTNIDDEDVRYNFLYYATFDE 160
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap