Conserved Protein Domain Family
PHA01814

?
PHA01814: PHA01814 
hypothetical protein
Statistics
?
PSSM-Id: 107084
View PSSM: PHA01814
Aligned: 4 rows
Threshold Bit Score: 168.516
Threshold Setting Gi: 29565727
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66395201    1 MKITTTLDTKKLINYILNNRECFMNKITKFTSLSEKCVVFVIYGDISIEYYD--NDTKNKNDLFTLEIDIDIHKHVFNCL 78 
29565727    1 MKIKTTFRLNNLIYYLLTNRDYYNDKFEKFTSSNKKCIVKINMGDVYIEFDKqyDDFEIEKELFTLDIDIDIKKHVFNIL 80 
29565749    1 MKIKTTFRLNNLIYYLLTNRDYYNDKFEKFTSSNKKCIVKINMGDVYIEFDKqyDDFEIEKELFTLDIDIDIKKHVFNIL 80 
157738592   1 MNITTTLNTKKLINYILDNRDCFMNKITKFTSLSGKCVVFVRYGEISIEYYD--SDTKNNNDLFTLDIDVDINKHVFNCL 78 
66395201   79 KVYYIEHTEDINIiykKGVYMGCTIDDVLSHFEKPLESDITIIYQNKVIYYNGKVIDHE 137
29565727   81 VFYYRNYLSNELI---REILLNVTIDDVLSNFDKPLESELMIIYQNKVIYDNGKVIDHE 136
29565749   81 VFYYRNYLSNELI---REILLNVTIDDVLSNFDKPLESELMIIYQNKVIYDNGKVIDHE 136
157738592  79 KVYYIEHTEDINIiykKGVYMGCTIDDVLSYFEKPLESDITIIYQGKVIYEYGKVIDHE 137
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap