Conserved Protein Domain Family
PHA01812

?
PHA01812: PHA01812 
hypothetical protein
Statistics
?
PSSM-Id: 177325
View PSSM: PHA01812
Aligned: 4 rows
Threshold Bit Score: 182.598
Threshold Setting Gi: 157738590
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66395203    1 MTNVKDILSRHQNTLARFEFEEKEREFIKLSELVEKYGMKKEYIVRALFTNKESKFGEQGVIVTDDYNVNLPNHLTDLIK 80 
29565747    1 MTNVKDILSRHQNTLARFEFEEKEREFIKLSELVEKYGMKKEYIVRALFTNKESKFGEQGVIVTDDYNVNLPNHLTELIK 80 
29565725    1 MTNVKDILSRHQNTLARFEFEEKEREFIKLSELVEKYGMKKEYIVRALFTNKESKFGEQGVIVTDDYNVNLPNHLTELIK 80 
157738590   1 MTNVKEILSRHQNTTARFEFEEKEREFIKLSELVEKYGIKKEYIVRALFTNKESKFGVQGVIVTDDYNVNLPNHLTELIK 80 
66395203   81 EMRADEDVVDIINAGEVQFTIYEYENKKGQKGYSINFGKVSF 122
29565747   81 EMRADEDVVDIINAGEVQFTIYEYENKKGQKGYSINFGQVSF 122
29565725   81 EMRADEDVVDIINAGEVQFTIYEYENKKGQKGYSINFGQLSF 122
157738590  81 EMRSDEDVVNIINAGEVQFTIYEYENKKGQKGYSINFGQVSF 122
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap