Conserved Protein Domain Family
PHA01811

?
PHA01811: PHA01811 
hypothetical protein
Statistics
?
PSSM-Id: 177324
View PSSM: PHA01811
Aligned: 4 rows
Threshold Bit Score: 137.042
Threshold Setting Gi: 157738589
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
29565724   1 MKVDDIVTLRVKGYILHYLDDDNEYIEEFLPLHEYHLTKTQAKELLPDTCKLLSTTRTTKTIQVYYNDLLQIAIAESK 78 
157738589  1 MKADDIITLRVKGYIFHYLDESNEYIEEFIPLHEYHLTKTQAIELLPNTCTLLSTTRKTKKIQVYYNDLLQISIKEEK 78 
29565746   1 MKVDDIVTLRVKGYILHYLDDDNEYIEEFLPLHEYHLTKTQAKELLPDTCTLLSTTRTTKTIQVYYNDLLQIAIAESK 78 
66395205   1 MKPDDIVTLRIKGYILHYLDDNNEYIEEFIPYHDYHLSKQQAKDLIPQSYTLLSTTRHTKTMQVYYNDLLQISIAESK 78 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap