Conserved Protein Domain Family
PHA01810

?
PHA01810: PHA01810 
hypothetical protein
Statistics
?
PSSM-Id: 177323
View PSSM: PHA01810
Aligned: 4 rows
Threshold Bit Score: 178.398
Threshold Setting Gi: 157738588
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66395204    1 MVNVDNAPEEKGQSYTEMLQLFNKLIQWNPAYTFDNAINLVSACQQLLLNYNSSVVQFLKDELNNETKPESILSYIAGDD 80 
29565745    1 MVNVDNAPEEKGQAYTEMLQLFNKLIQWNPAYTFDNAINLVSACQQLLLNYNSSVVQFLNDELNNETKPESILSYIAGDD 80 
29565723    1 MVNVDNAPEEKGQAYTEMLQLFNKLIQWNPAYTFDNAINLLSACQQLLLNYNSSVVQFLNDELNNETKPESILSYIAGDD 80 
157738588   1 MINVDNAPSEKGQAYTEMLQLFNKLIQWNPAYTFDNAINLVSACQQLLLNYNSSVVQFLNDELNNETKPESILAYIAGDD 80 
66395204   81 PIEQWNMHKGFYETYNVYVF 100
29565745   81 PIEQWNMHKGFYETYNVYVF 100
29565723   81 PIEQWNMHKGFYETYNVYVF 100
157738588  81 AIEQWNMHKGFYETYNVYVF 100
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap