Conserved Protein Domain Family
PHA01795

?
PHA01795: PHA01795 
hypothetical protein
Statistics
?
PSSM-Id: 177320
View PSSM: PHA01795
Aligned: 3 rows
Threshold Bit Score: 474.461
Threshold Setting Gi: 281416378
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157311176   1 MDLLIEKESQATRLSDFGIYNIAIEDSAPLLSVSHRAVKGRSGYIYDGATFTTKTLKVKGRVTVSDVEGVLDKQDELNAL 80 
28876450    1 MDLLIEKESQATRLSDFGIYNIAIEDSAPLLSVSHRAVKGRSGYIYDGATFTTKTLKVKGRVTVSNVERLLDKQDELNAL 80 
281416378   1 MDLKIEKENLSTRMSSLGVLVIDINSTNSIVEINTKKIDGTNRSLFLGATHSEKKITVSGYYYVENELQDEYMKDKLNGT 80 
157311176  81 LVVDEPFYVTKMYPENSDLFNFELPGESTGDLQLIGSPHKPWKYRFKVILDDTITYEFIGKTSQGLKYNLSFTLRTAELP 160
28876450   81 LVVDEPFYVTKMYPENSDLFNFELPGESTGDLQLIGSPHKPWKYRFKVILDDTIAYEFIGKTSQGLKYNLSFALRTAELP 160
281416378  81 FADTEPFYITKMY-TNQSLYGYERPGEKQGFDMLRVDKQRQYHYRYKVLLDGEINYDFQGFSDVGLLYEVSLTFKTVDLP 159
157311176 161 FGETKPKDITLSGGSF-AYGGTAKASQLEWPFIIELTPSGG-QTNFYIEIDGRRFEFKQNSQLQNSDKLLLTGIATTLNG 238
28876450  161 FGETKPKDITLSGGSF-AYAGTAKASQLEWPFIIELTPSGG-QTNFYIEIDGRRFEFKQNSQLQNSDKLLLTGIATTLNG 238
281416378 160 FGITIPDDIEITNSKMiEYRGTVPCSQLEWPWKVQIIAKKNlGAEFKLSIDEREFKYVGKRNILSGDKFLLEGTSFTLNG 239
157311176 239 NYVNAKTNYEYFIFNPNPNKRITYKTDF-LG--TIRILNFVELYK 280
28876450  239 NYVNAKTNYEYFIFNPNPNKRITYKTDF-LG--TIRILNFVELYK 280
281416378 240 LNINDQTNIEYFILKPNEVGFIPFSTSFnIGevEINILNKVDLYR 284
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap