Conserved Protein Domain Family
PHA01790

?
PHA01790: PHA01790 
streptodornase
Statistics
?
PSSM-Id: 164869
View PSSM: PHA01790
Aligned: 2 rows
Threshold Bit Score: 622.56
Threshold Setting Gi: 157311188
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
28876439    1 MSKKLRNSLARIVVAAFASFAVMAIPTYHHSTVLAKTVSVNQTYGEYKDYYTVIGESNIDQSAFPKIYKTTERVYKGQGT 80 
157311188   3 MSKKLRNSLARIVVAAFASFAVMAIPTYHHSTVLAKTVSVNQTYGEYKDYYTVIGESNIDQSAFPKIYKTTERVYKGQGT 82 
28876439   81 SEKRVTVSDVVYNPLDGYKRSTGAYGVVTKDMIDMSKGYREKWETNPEPSGWFRFYNRADNEEISEKEYDSRRTKSYKVT 160
157311188  83 SEKRVTVSDVVYNPLDGYKRSTGAYGVVTKDMIDMSKGYREKWETNPEPSGWFRFYNRADNEEISEKEYDSRRTKSYKVT 162
28876439  161 NNVPVVLTTLKGKQYNSHLFVRSHLFADSLGGKSIRKNAITGTQMQNVGTRKGGMQYIEKKVLSHITKNPDVYVFCSAIP 240
157311188 163 NNVPVVLTTLKGKQYNSHLFVRSHLFADSLGGKSIRKNAITGTQMQNVGTRKGGMQYIEKKVLSHITKNPDVYVFYSAIP 242
28876439  241 EYQGTELLARSVLVSALSSDGVINETVRVFNTADGFNINYEKGGLLTESPVSEIDNIEDSTTDEIENSVDDSEEIVYNDT 320
157311188 243 EYQGTELLARSVLVSALSSDGVINETVRVFNTADGFNINYEKGGLLTESPVSEIDNIEDSTTDEIENSVDDSEEIVYNDT 322
28876439  321 TTEEEN 326
157311188 323 TTEEEE 328
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap