Conserved Protein Domain Family
PHA01782

?
PHA01782: PHA01782 
hypothetical protein
Statistics
?
PSSM-Id: 177318
View PSSM: PHA01782
Aligned: 10 rows
Threshold Bit Score: 211.613
Threshold Setting Gi: 197935855
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
281306661   6 NATTALVQPEFILGASEINRASDTIADKGAKLDDFIQYTALSVLNHVQLHGDVTVANKLFASMPKGSRKTALADFLVKYG 85 
33300814    1 MTNAISKTVIAFRGTEEINRAIDAIRVRGKELDEAIQLTGLSIIHHIDQCGDVTVVKALYEAMPNGSRRNALVEWLVLHG 80 
158345027   1 MTNQLTKTVIAFVGKAAITNAIEAIRVRGKELDEAIQLTGLSILNHVDLHGDVTVVKALYEAMPKGSRRNALVEWLTMFG 80 
158345138   1 -----------MRTQKQILTAIQHVAITGKCLDESVQSIGLDILQHVDAHGEVSLACKLLKALPKGARGKALADWFQTYG 69 
40549404    1 -----------MSDYKRINGIIKTIANRGAALDKLVQTTGMDILKHIDEHGEVSLACKLFNAMPQGSRRLALAHWFVDNG 69 
167600446   1 MTNAISKTVIAFRGTEEINRAIDAIRVRGKELDEAIQLTGLSIIHHIDQCGDVTVVKALYEAMPKGSRRNALVEWLVLHG 80 
195546705   1 MTNAISKTVIAFRGTEEINRAIDAIRVRGKELDEAIQLTGLSIIHHIDQCGDVTVVKALYEAMPKGSRRNALVEWLVLHG 80 
195546644   1 MTNAISKTVIAFRGTEEINRAIDAIRVRGKELDEAIQLTGLSIIHHIDQCGDVTVVKALYEAMPKGSRRNALVEWLVLHG 80 
197935855  14 TKPKKEATLSLIVGAALIGKEIDSIKTAAAKLDTRIHVAALSVASHAHEHGDVTLAQKLVEALGKGMRRNALLAWLVKFG 93 
225626325   1 MTNQLTKTVIAFVGTAAITNAIEAIRVRGKELDEAIQLTGLSILNHVDLHGDVTVVKALYEAMPKGSRRNALVEWLTMFG 80 
281306661  86 KMAVETDRTKAKVNPFAYDKSKATNIEAARAKPWYEHKKEPEPIDSLDVHAMIAMLVKRIERDEAKGGKVEGDNVtlLTD 165
33300814   81 KVQVNTDKKSNKDLPFLYNKFGKTDLVGATNSPWYSFKPEKALDQEFNLAAALATIKKQVLQAQTKGKVIVGMEL--LGD 158
158345027  81 KVQVNTDKKTNKEHPFLHNKFGKTDLVGATDQPWYGFKPEKSLDQEFNLAAALAAVRKQVLQAQTKGKVIVGAEL--LGD 158
158345138  70 KITVNTDKATAKQFPLVFNKDGSTDLEGAAAKQWYKCKPDRPLAVEFDFASQLASLLKRAAEAEAKGLAVKGADA--LEK 147
40549404   70 KIEANTDKEKAKEFPFVFAKDKATRLERAAEKPWFKYKKERDVADEFSLDQAIAAFKAKIQRAIDKGQLQAADER--IAV 147
167600446  81 KVQVNTDKKSNKDLPFLYNKFGKTDLVGATDNPWYSFKPEKALDQEFNLAAALATIKKQVLQAQTKGKVIVGMEL--LGD 158
195546705  81 KVQVNTDKKSNKDLPFLYNKFGKTDLVGATNSPWYSFKPEKALDQEFNLAAALATIKKQVLQAQTKGKVIVGMEL--LGD 158
195546644  81 KVQVNTDKKSNKDLPFLYNKFGKTDLVGATNSPWYSFKPEKALDQEFNLAAALATIKKQVLQAQTKGKVIVGMEL--LGD 158
197935855  94 PFAPSEDGKS-----VVHAKGTEFDLESAKARPWYDFKQEPAF-RPFDLDAMLEKLVENATKALNDKEHPDAHNVn-AAK 166
225626325  81 KVQVNTDKKTNKEHPFLYNKFGKTDLVGATNEPWYGFKPEKSLDQEFNLAAALAAVRKQVLQAQTKGKVIVGAEL--LGD 158
281306661 166 LKLLAARPVAAAQPAPATV 184
33300814  159 LEALAAKAAPIAGLITSEN 177
158345027 159 LEVLAAKAAPMVEKAKRAA 177
158345138 148 CKGLVCYVTSPE------- 159
40549404  148 IQRLEVKDEAKAA------ 160
167600446 159 LEALAAKAAPIAEQSKRAA 177
195546705 159 LEALAAKAAPIAEQSKRAA 177
195546644 159 LEALAAKAAPIAEQSKRAA 177
197935855 167 LERIKALIAGDL------- 178
225626325 159 LEVLAAKAAPMVEKAKRAT 177
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap