Conserved Protein Domain Family
PHA01756

?
PHA01756: PHA01756 
hypothetical protein
Statistics
?
PSSM-Id: 107069
View PSSM: PHA01756
Aligned: 3 rows
Threshold Bit Score: 413.984
Threshold Setting Gi: 159341078
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22122261    1 MSVTYTSISSLLASPFQRLTSSMWNTATLLLYQLYETGGNSLTSILQNGNLYIPNNISALAGFFQKEVYVSGQPVLTEQD 80 
22122315    1 MSVTYTSISSLLASPFQRLTSSMWNTSVLLLYQLYETGGNTVSQILQNGNLYIPNNISALSGFFQKEVYVSGQPVLTEQD 80 
159341078   9 MSITYASISDLLAKPFQRLTSSMWNAVVLELNQVYFGGSLIDRKLFVDNNLYVPQNLFAMTGDFYNEVYVAGQPVLTEQD 88 
22122261   81 PIYIAGFIGTANQQINQILYSNQQLYYSISQLPK---EISYDLYTNLYRTISDLTSTLSSQISQLQKTGI---------- 147
22122315   81 PIYIAGFIGTANQQINQVLYSNQQLYYSISKLPK---EISYDLYINLYRTISGLTSSLSSQIAQLQKTGI---------- 147
159341078  89 PIYIAGFISTAYNQISAILASQQQLYTAISNIPHslgNIAYPLDV-LYRNLQSIQSGFYGILQQFLYQTAqnfnvflgel 167
22122261  148 -------------------------------NALYSIADFLAYTFTYFYLATVGLANTLNKLTLFLSPPTIEGLQISLST 196
22122315  148 -------------------------------NALYSIADFLAYTFTYFYLATVGLVNTLNKLTLFLSPPTIEGLQISLST 196
159341078 168 yklsespvfnewytlyntnailqqalnvylpKTLTTLADTVIYDLFYMYLATATLANAINKLTVYLSPSSVQGLSISVGQ 247
22122261  197 IPSPIYNGSTIETVRIILQNLSNYIVYIGNKLYNSFPILPGDSLEFHVRNPSNVYAWATGKCTVYALFEVVQ 268
22122315  197 VPSPLYSSSTLETVRIILQNLSNYIVYIGNQLYNSFPILPGDSLEFHVRNPSNVYAWATGKCTVYALFEVVQ 268
159341078 248 SPAPIYSGPALQTVKIILQNLSNYIIYIGNSIYNNFPILPNNNVEFRISNPANVYAWSTGPATVYALFEVT- 318
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap