Conserved Protein Domain Family
PHA01753

?
PHA01753: PHA01753 
Holliday junction resolvase
Statistics
?
PSSM-Id: 133958
View PSSM: PHA01753
Aligned: 3 rows
Threshold Bit Score: 208.206
Threshold Setting Gi: 159341083
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22122308    1 MNIRQSGKYYEYKTLEILEENGFKALRIPVSGTGKQALPDIIATKDNTIYPIEVKSTSKDVITIKKFQIEKLFEFCEIFD 80 
22122254    1 MNIRQSGKYYEYKTLEILEKNGFKALRIPVSGTGKQALPDLIATKNNTIYPIEVKSTSKDVVTVRNFQIEKLFKFCEIFN 80 
159341083   3 INIHNSGRYFEYQAMEWLQSHGYQTIRIPASAAGKQPLPDIIATKNSVVYAIEVKSTSNRLVRVDKFQIDKLYRFCNVFS 82 
22122308   81 FCNCQPLVAIHYKKYKTVIVYTLPQDVRAKEKIKFKYGINS 121
22122254   81 FCECHPLVTVYYKKYKIVIVYELSQDVRTKEKIKFKYGINS 121
159341083  83 FCECKPIVMVRFKGSRQWKIVEVTRNAGIVVKL-------- 115
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap