Conserved Protein Domain Family
PHA01752

?
PHA01752: PHA01752 
hypothetical protein
Statistics
?
PSSM-Id: 177317
View PSSM: PHA01752
Aligned: 2 rows
Threshold Bit Score: 892.869
Threshold Setting Gi: 22122252
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22122306   1 MTLYDIYIHYAICEFIFLVEIYKLIVMGKRKGQRNISAMKYHLYNKILNRKSFPAFSVMFNAGVESVLPTPLESIQIPPG 80 
22122252  23 SIMYDIYIHYAICKFIFLLEIYKLIAMGKRKGQRNIASMKYHLYNKILNRKSFPAFSVMFDAGVESVLPTPLENIQIPLG 102
22122306  81 INTNYGIAYASIISTLLSALNNLASSVFNPNFNSQTFLSLGQSSNFGISNGINLLNNYTSLYDNYVELCNILYQPAVFDE 160
22122252 103 INTNYGIAYASIISSLLSALNNLAISVFNPNFNSQTFLNLGQSANFGISNGISLLNNYTSLYDNYVQLCNILYQPAVFDE 182
22122306 161 TYFDLSVYQPALSTEYQNQSCGKIEQYFSSLTTTNVSVDITTLGIGSTNIPNVDNYMYNNISDTGIIDLLNALNINFNQL 240
22122252 183 TYFDLSVYQPALATEYQNQSCKKIEQYFSSLTTTNVSVNVTTLGTGITNIPNVDNYMYNNIADTGIIDLLNALNINFNQL 262
22122306 241 PDFAKFVIAFIPDLNSIINSGFALDVAWLDRCVLAPETENGIQLQNGMILQYFADVFGMILDYTPLDFAVLMPDFNPENV 320
22122252 263 PDFAKFIIAFIPDLNSIINNGFALDVGWLDRCVLAPETQNGIQLQNGMILQYFADVFGMILDYTPLDFAVLMPEFNPENV 342
22122306 321 TQDDLIAILSADKTVISIFGNLFKMHLYDPSPGGTNIAYSSEIENYAVSYEQFLQIQKIVNKKYSNIWYAKMIASATIEI 400
22122252 343 TQDDLIAILSADKTVISIFGNLFKMHLYDPSPGGINIAYSSEIENYAVSYQQFLQIQKIVNKKYSNIWYAKMVASATIEI 422
22122306 401 ARYPYQQNYSYTSGKRTLPYQEFLNYWKTKWKFYGLTDQDLQFAQQLGEQLQGQAKIENQIKLAQKSAKTKQYKPIFYYK 480
22122252 423 ARYPYQQNYSYTSGKRTLSYQDFLNYWKTKWKFYGLTDQDLQYAQQLGEQLQGQAKIENQIKLAQKSAKTKQYKPIFYYK 502
22122306 481 NFQNIANR 488
22122252 503 NFQNIAVR 510
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap