Conserved Protein Domain Family
PHA01749

?
PHA01749: PHA01749 
coat protein
Statistics
?
PSSM-Id: 177316
View PSSM: PHA01749
Aligned: 3 rows
Threshold Bit Score: 229.998
Threshold Setting Gi: 22122246
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22122299    1 MAKGHTSRSYSQRYAKWQAKFNAFSNPTVASTILSNVSPVAQQNFQTNVPKFTSVNENVSAVLTQYGITGPNRAIYQGFG 80 
159341082   1 MAKGHTPRSYSQRYSKWSGKFTAFSNPTVSSTILSNVSQIAQENFQTNVPKFTSTNENVSAVLTQYGVTGPSRAIYQGFG 80 
22122246    1 MAKGHTKRSYSQRYAKWQAKFNAFSNPTVASTILSNVAPVAQQNFQTNVPTFTAVNENVSAVLSQYGITGPNRAIYQGFG 80 
22122299   81 LKVARALNRIGSGPALVNMINGLKGYYISAFNANPQVLDAVVNIITGSPTGYVS 134
159341082  81 LKVERALNRIGSGPALTNMINGLKAYYVSAFGANPEILDAVTNIITGSPNGYVS 134
22122246   81 LKIARALNRIGSGPALVNMINGLKSYYISAFNANPQVLDAVVNIITGSPTGYVS 134
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap