Conserved Protein Domain Family
PHA01740

?
PHA01740: PHA01740 
putative single-stranded DNA-binding protein
Statistics
?
PSSM-Id: 133956
View PSSM: PHA01740
Aligned: 2 rows
Threshold Bit Score: 315.163
Threshold Setting Gi: 48696651
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
48696651   1 MAQYDNTNRGTLGKNRQPKNDKSPHFTGKVDIRGTVYWLAGWRQEDFMSDDHYISLSLTGKDDASLTGSGRLENNRDKIG 80 
48696693   1 MAQYDNTNRGTLGKNRQPKNDKSPHFTGKVDIRGTVYWLAGWRQEDFMSDDHYISLSLTGKDDASLTGSGRLENNRDKIG 80 
48696651  81 NRPDMVGRVIVEGAEYEISAWTKTHDNGKFLSIQVRAAGVRRPQDDKQFGTAYGDSHEDGTRPKYNEPPMDFDDDIPF 158
48696693  81 NRPDMVGRVIVEGAEYEISAWTKTNDNGKFLSIQVRAAGVRRPQDDKQFGTAYGDSHEDGTRPKYNEPPMDFDDDIPF 158
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap