Conserved Protein Domain Family
PHA01733

?
PHA01733: PHA01733 
hypothetical protein
Statistics
?
PSSM-Id: 107055
View PSSM: PHA01733
Aligned: 3 rows
Threshold Bit Score: 267.141
Threshold Setting Gi: 61806432
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148724485   1 MKPYYRPATSRDAVLVANNLRKEDRMEI-EGLGQHPLVLPFCVLSSDAPVAFFNSEGELAGVAGIMPDerehvGQVWMIC 79 
61806432    1 MSKFIHPVTKEAALDVASNLLPDDRREVeEGHGHDPVKVIPLCAAYGDSVYFTVPNGDLAGVAGVQED-----GRIWMLC 75 
18640501    3 QSDNNRPATQADITELIQNIRQEDREEI-EGLGHSVLALHLSLDVSENVTAMVAPDGSIAGVAGLV-DmgnrvGEIWMVC 80 
148724485  80 TPAVQKNPHHLVRQAKKWLDe-QRNYRLLWNLADARNLFHQKLLRLLGFKAIAAQPAGPYGLPFLEIVKLCASPQ 153
61806432   76 TPAIHKYPLTFAREAKRYVE--SREEKLLWNIVDKRNRVHIKLLRFLGFKFLRELKHGPNQLPFMEFCRVFRSGC 148
18640501   81 TKAIERNPIALLKGAKWWLPkvSKNYDILYNIVSKDNLVHRRLLKKLGFRGLRYVQPAPLYKPYIEFVKKCASS- 154
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap