Conserved Protein Domain Family
PHA01634

?
PHA01634: PHA01634 
hypothetical protein
Statistics
?
PSSM-Id: 133954
View PSSM: PHA01634
Aligned: 9 rows
Threshold Bit Score: 248.998
Threshold Setting Gi: 22122314
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22122260    1 MNFDDYFCKLQCCYWREFEFAYSKLDVKDKTITIIGNDCGSSALYFLLKGAKKIIGFEKEEKLNQIFKEtVCKEFKICDK 80 
159341092   1 MDIENYFRNLECDYWREYPRSYGLLNVYQRTVQIVGADCGSSALYFLLRGASSVVQYEKEEKLRKKWQQ-VCADFSICDK 79 
22122314    1 MNYDDYFCKLQCCYWREFDFAYSRLDVKDKTITIIGNDCGSSALYFLLKGAKKIIGFEKEEKLNQIFKEtVCKEFKICDK 80 
16753150    2 ISIADYFRQKDCDYWREYPHSYGKLDVFGKTIQIVGADCGSSALYFLMRGAKYIIQYEKEEHLRKRWEE-ACKYFNICDK 80 
162329348   2 ESIEEYFKKRECDYWREYPHSYGMLNVYQRSIQIVGADCGSSALYFLLRGASFVVQYEKEEHLRKKWEE-VCAYFNICNK 80 
162329418   2 ESIEEYFKKRECDYWREYPHAYGMLNVYQRSIQIVGADCGSTALYFLLRGASFVVQYEKEEHLRKKWEE-VCAYFNICNK 80 
162329477   1 --MEEYFRKRECDYWREYPHEYGMLDVYRRSIQIVGADCGSSALYFLLRGASFVVQYEKEEKLRKKWEE-VCSYFNICDK 77 
162329538   2 ESIEEYFKKRDCDYWREYPHAYGMLNVYQRSIQIVGADCGSTALYFLLRGASFVVQYEKEEHLRKKWEE-VCAYFNICNK 80 
171473709   1 MNIEEYFRQKECDYWREYPHSYGLLNVFNKTIQIVGADCGSSALYFLLRGAKYIIQYEKEEHLRKKWNE-VCQYFNICDK 79 
22122260   81 VESKGEWKSnEYPDTDILVMDCEGCEKNLDFSKLQKYKQYCIAIHDWTENRFDLLRKLYGTILTFVTDDNREFVFCKL 158
159341092  80 AVMKEEWNG-EYEDTNIFIMDCEGCEEKLNVSQLNKYSQWCIGVHDWAKNRVELLRKLEGATFTYASDDGREITLCRI 156
22122314   81 VEIKGKWKGnEYPDTDILVMDCEGCEKNLDFSKLQKYKQYCIAIHDWTENRFDLMRKLYGSILTFVSDDNREFVFCKL 158
16753150   81 AMMKNEWNG-EYENADIFVIDCEGCEEHLNVDILKKYEQWCVGIHDWTKNRVELMRKMEGTIFTYVSDDGREMTLCKT 157
162329348  81 AVMKGEWDG-VYENVDIFVMDCEGCEEKLNVNMLTRYKQWCVGIHDWTKNRVELMRKMEGATFTYVSDDGREITLCKI 157
162329418  81 AVMKGEWDG-VYENVDIFVMDCEGCEEKLNVNMLTRYKQWCVGIHDWTKNRVELLRKMEGATFTYVSDDGREITLCKI 157
162329477  78 AEMKEEWNG-QYDDVDIFVMDCEGCEEKLDVSQLKKYKQWCVAIHDWTHNRVELLRKMEGMTFTYVSDDGKEIVLCKI 154
162329538  81 AVMKGEWDG-VYENVDIFVMDCEGCEEKLNVNMLTRYKQWCVGIHDWTKNRVELMRKMKGATFTYVSDDGKEITLCKI 157
171473709  80 ATMKKEWNG-EYENVDVFVMDCEGCEEQLNVDMLKKYEQWCIGIHDWTKNRVELMRKMEGTIFTYVSDDGREITLCKT 156
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap