Conserved Protein Domain Family
PHA01633

?
PHA01633: PHA01633 
putative glycosyl transferase group 1
Statistics
?
PSSM-Id: 107050
View PSSM: PHA01633
Aligned: 3 rows
Threshold Bit Score: 645.496
Threshold Setting Gi: 159341081
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22122301    1 MKTAILTMNYSSISNVSEDIAEVLrenGEIATITKNPFYIPKA---EKLIVFIPFHPPSLNPYLYAYYQFQGKKYFYTTC 77 
159341081   1 MKTLVLTMNYSSIRNVAEDISETI---GNAVVDITPELYINTTqhfERLIVFVPFIPPMLNNYLLVYNMFKGPKYFYTTA 77 
22122248    1 MKTAILTMNYSSISNVSEDIAEVLrenGEIVTITKNPFYIPKA---EKLIVFIPFHPPSLNPYLYAFYQFNGKKLFYTTC 77 
22122301   78 DGIPNIEIVNKYLLQDVKFIPNSKFSAINLQEVGLQVDLPVFHGINFKIVENAEKLVPQLKEKLNKDFPGSIKFGIVSGL 157
159341081  78 DGVPSTDIINRHLLRDVTFIPNSNFTAENLSTAGLSVDIPVFHGINFKIVEKAKSLVPKLKQKLDNDFPDTIKFGVVTGM 157
22122248   78 DGIPNIEIVNKYLLQDVKFIPNSKFSAMNLQEVGLQTDLPVFHGINFKIVENAEKLVPQLKQKLDKDFPNTIKFGIVSGL 157
22122301  158 TKRKNMDLMLQVFNELNTKYPDIAKKIHFFIISHKQFTQYEVPANVHFVAEFGWNSREYIFAFYGAMDFVIVPSGTEGFG 237
159341081 158 TKRKNIDLFVQTTKLLNEKFPDPAKRIHFFVISHEDFKKLEVPANVHFVAAFGHQPRENVLAFYGAMDFTFMPTGCEGFG 237
22122248  158 TKRKNMDLMLQVFNELNTKYPDIAKKIHFFVISHKQFTQNEVPANVHFVAEFGFNSREYIFGFYGAMDYIIVPSGTEGFG 237
22122301  238 MPVLESMSMGTPVIHQLMPPLDEFTSWQWNLLIKSSKVEEYYDREHGQKWKIHKFDIEDMLNAIILATELEDREERSEKL 317
159341081 238 LPLLESMAMGTPVIHQAIPPLTEFTSWQWNYLFRYNTVENYADKDHAQSWKIYRFQPEDAAAAILTAFLSQDREERSMHL 317
22122248  238 MPVLESMAMGTPVIHQLMPPFDEFTSWQWNLLIKSSKVEEYYDKEHGQKWKIHKFEIEDMINAIILASELQDREERSTKL 317
22122301  318 KELAKKYDIRNLYTRFLE 335
159341081 318 MELAKKYDVSFLYKRFLE 335
22122248  318 KELAKRYDIRNLYTRFLE 335
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap