Conserved Protein Domain Family
PHA01632

?
PHA01632: PHA01632 
hypothetical protein
Statistics
?
PSSM-Id: 133953
View PSSM: PHA01632
Aligned: 5 rows
Threshold Bit Score: 97.6211
Threshold Setting Gi: 171473652
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22122303   1 MISYYYDEKDKTLHIKIHILIEQVPNKPTEEELRKVLPKILKDYGNMIENKKEKIIDSKEWGLW 64 
16753147   1 MISYKYGEKDKTLHVKIYVLIEHVPQKPSEEELRKVLPKILKDFANMVEQGKIKILDSDEWGIW 64 
22122249   1 MITYYYDEKNKELHIKIYILIDQVPNKPTEEELKKVLPKILKDYANMIENGKMKLIDSKEWGIW 64 
171473705  1 MISYQYDDKNKILHIKIYLLIEQVPKKPTQNELKKVLPKILKDYANMIEKGEVKIMDSNEWGLW 64 
171473652  1 MITYQYDEKNKLLHIKIYIAVDEVPQEPTEEQLRKALSKMLIDYAKMVEEGKIKILNSKKWGIW 64 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap