Conserved Protein Domain Family
PHA01631

?
PHA01631: PHA01631 
hypothetical protein
Statistics
?
PSSM-Id: 164862
View PSSM: PHA01631
Aligned: 3 rows
Threshold Bit Score: 290.298
Threshold Setting Gi: 22122262
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22122316    1 MKIFTFVGFTKHLDELDFDYIVVDKTFNDMTEEQIEKYQEKIIWIMTNTEIRWLRIAKQLLTIVNFAKNIEDDIIAIIDS 80 
22122262    9 MKIFTFVGFTKHLDELDFDYVVVDKTFNDMSDDQIKKYQEKIIWIMTNTEIRWLRIAKQLLTIVNFAKNIEDDIIAIIDS 88 
159341090   1 MKIFTFCGNCAHIQETQYDYVVVDQTYY----CNLPKDAHDIIWNVTQSDDRQTRIALNLLKALNFISHLPDDIFAIIDS 76 
22122316   81 DLIIPNLREI----IPNERVFTPCYWLYYDWANEIRPFCSGTNYIMRKSLLPYLEYTINTYIENEYYKEIPVDIFIHNFI 156
22122262   89 DLIIPNLREI----IPNERIFTPCYWLYYDWANEIRPFCSGTNYIFRKSLLPYLEYTINTYIENEYYKEIPVDIFIHNFI 164
159341090  77 DVVVPNIHAIdghqMLRTYVFTLCYPLFYDWAGEIRPFCSGTNFVFTRGFATDIQNTIRDWMIADPKTRDKIDIYIHNHL 156
22122316  157 PHMNILKLGTIHYVKTPMEK 176
22122262  165 PHMNILKLGTIHYVKTPIGE 184
159341090 157 RHINVFIPPVSHYIKGRkvt 176
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap