Conserved Protein Domain Family
PHA01630

?
PHA01630: PHA01630 
putative group 1 glycosyl transferase
Statistics
?
PSSM-Id: 164861
View PSSM: PHA01630
Aligned: 9 rows
Threshold Bit Score: 453.09
Threshold Setting Gi: 159341088
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
159341088   1 MIIYYVYPMHHDVSFKYVALEHIKMLKTKYTVYDIPELNFYQFTPfGKPLTFVHPFFYGMVNWTKIqwaffkmyrSKVKQ 80 
22122263    3 KTIFYVYPQHHDVSFKFVAQEHVKMLREKYIVYEIPTLSFYQFTPfRYPISIIHPLFYSMWKWGKIefsffeqyrTRVSA 82 
22122317    3 KTIFYVYPQHHDVSFKFVAQEHVKMLREKYVVYEIPTLSFYQFTPfRYPISIIHPLFYSMWRWSKVefsffeqyrTRVSA 82 
16753130   23 IALVRDLTNNSFGRQATLLEKGLKELGHEVTSFEKNSIRKEDLPP-GFDDYIYYTIFNTQLFWKGI---------PKHGK 92 
162329523   3 IALVRDFVDISFGRQGKLLEKGLKELGHEVTPFEKNTTTKEKLPP-GYDAYVYYTIFNTQLFWKGI---------PHHGK 72 
162329462   3 IVLVRDFKEGSFSRQASLLSFSLKQLGHTVVEFDKDKTTKMMLPM-AFDAYVYYTVFNSPLFWKGI---------PHYGK 72 
162329403   3 IALVRDFVDTSFGRQGKLLEKGLKELGHEVTPFEKNTTTKEKLPP-GYDTYVYYTIFNTQLFWKGI---------PHHGK 72 
162329333   3 IALVRDFVDTSFGRQGKLLEKGLKELGHEVTPFEKNTTTKEKLPP-GYDAYVYYTIFNTQLFWKGI---------PHHGK 72 
171473691   3 IALVRDFIDTSFGRQGKLLEKGLKELGHEVIPFDKNKTRKEDLPP-GFNDYIYYTIYNTQLFWKGI---------SHHGK 72 
159341088  81 LIGVEVADSDRIADNFINIA-NSWADALVVNSRWSYDAYVKSGLKI--PVYMVQHNYDPKLempdeklkvsqeirkIADK 157
22122263   83 LLGVEVADTDKIAKQYIEYA-NNFTDGMILNSEWSVNAFKNSGLKV--PAYKVFHNFKDRLlakneelklddqilyIEKL 159
22122317   83 LLGVEVADTDKISEQYIEYA-NNFTDGMILNSEWSVNAFKNSGLKV--PAYKVFHNFKDRLlakdeelklddqilyIEKL 159
16753130   93 NIVFEVADTDAISSVALYFFrHQPVDKIIVPSQWSKNAFYTLKLPIpqPIYVIPHALNPSM---------------FSYP 157
162329523  73 NVVFEVSDTDAISHTALYFFrKQPVDEIVVPSQWSKNAFYTLRLPIpqPIYVIPHALNPDM---------------FSYK 137
162329462  73 NVVFEVSDTDRLSNLALYFFkEQPVDEIVTPSQWSKQGF----VGVnkPIHVIPHPLDPRM---------------FEYE 133
162329403  73 NVVFEVSDTDAISHTALYFFrQQPVDEIVVPSQWSKNAFYTLRLPIpqPIYVIPHALNPDM---------------FSYK 137
162329333  73 NVVFEVSDTDAISHTALYFFrQQPVDEIVVPSQWSKNAFYTLRLPIpqPIYVIPHALNPDM---------------FSYK 137
171473691  73 NIVFEVADTDAVSHTALYFFrQQPVDEIVVPSQWSKNAFYTLKLPIpqPIYVIPHALNPDM---------------FSYP 137
159341088 158 KKEKHIKVVLFFSWHSGYRKGDDLFQKIARKIQKERDDVYFLVKSpmprSDLADLRLINVTGV---VPFDDIVELYRIAD 234
22122263  160 KKEKNFKLIFISLWHSDYRKGADIFHVIAKELQKERNDIYFLVKSglprTDFQDLKMFNIFGN---TSFDNIVKMYRISD 236
22122317  160 KKEKNFKLIFISLWHSDYRKGGDIFHEIAKRLQNERNDIYFLIKSglprTDFQDLRMFNIYGN---TSFDNIVKMYRISD 236
16753130  158 PKEMPHPCVLAILPHSWDRKGGDIVVNVFRELMNSGYHFYPLILV----SNMLEPRLRGLNAVktpLPDPDYYSLFAGCD 233
162329523 138 PANVPHPCVLSILPHSWDRKGGDVVVKVFHELMNSGYHFYPLILV----SNMLEPRLRGLNAIktpLPDDQFYSLFAGCD 213
162329462 134 PANVPHPCVIGIIPHSWDRKGGDIVTWAFHQLANSGYKAYTLVTA----INTKDPRLFGLNVLkapLPDEQYYSLFAGCD 209
162329403 138 PANVPHPCVLAILPHSWDRKGGDVVVRVFHELMNSGYHFYPVILV----SNMLEPRLRGLNAVktpLPDDQYYSLFAGCD 213
162329333 138 PANVPHPCVLAILPHSWDRKGGDVVVRVFHELMNSGYHFYPVILV----SNMLEPRLRGLNAVktpLPDDQYYSLFAGCD 213
171473691 138 PKEMPHPCVLAILPHSWDRKGGDVVVKVFQELMKAGYHFYPLILV----SNMLEPRLRGLNAIktpLPDPDYYSIFAGCD 213
159341088 235 ITLLLSRGGSFELNGLESLVSGTPTIAPDEGPWVEYFPPALRHLLAKTAAHPIVLPDNPIHIGHGVEVGIDDVTEKALKI 314
22122263  237 LYLLTSRGGSFELNGLEAFISKIPALATKGGAWEDYYPPNLKDLLIDSCENPQIFPDNPIHIGNGVQMCIGKAIDKILEV 316
22122317  237 LYLLTSRGGSFELNGLEAFISKIPAIATKNGAWEEYYPENLRDLLIDSCKNPQIFPDNPIHVGNGVEMCIEKAIDKILEV 316
16753130  234 ILFYPVRGGAFEIPVIEALALGLDVVVTEKGAWSEWILNNDDVYWIKVNKKVKLWYTNLFHVGYFLEPDYNDAYQKLVMA 313
162329523 214 ILFYPVRGGAFEIPVIEALSLGLDVVVTEKGAWSEWVLSEDDVYWIKVGRKIKLWYTNPFHVGYFLDPDVEDAYQKLVMA 293
162329462 210 ILFYPVRGGAFEIPVIEALALGLDVVVTEGGAWSEWILSKDDVYWIKSRGLKRFWYTNPYHVGRFLDPDHEDAYQKLIVA 289
162329403 214 ILFYPVRGGAFEIPVIEALSLGLDVVVTEKGAWSEWVLSSDDVYWIKVGRKVKLWYTNPFHVGYFLDPDVEDAYQKLVVA 293
162329333 214 ILFYPVRGGAFEIPVIEALSLGLDVVVTEKGAWSEWVLSEDDVYWIKVGRKVKLWYTNPFHVGYFLDPDVEDAYQKLVMA 293
171473691 214 ILFYPVRGGAFEIPVIEALALGLDVVVTEKGAWSEWVLSEEDAYWIKVGRKVKLWYTNPFHVGYFLDPDTEDAYQKLVIA 293
159341088 315 LDNI--EEEKAKVKSQIGFFRENYSFNAIKNKLLGVVSQI 352
22122263  317 LDNY--DNYKAKIEENYNFWIENFSYNAVKKQLLEVMEKY 354
22122317  317 LDNY--DNYKAKIEENYNFWIENFSYNAVKKQLLNVVEKY 354
16753130  314 LANWhpEKKKENLENRAILYRERYNYINIAKEWEKILA-- 351
162329523 294 LADWtpEKKKENLEGRAILYREKYNYLEVAKMWEKIL--- 330
162329462 290 LADWtpEKKKENLEGRAILYREKYNYLEIARMWEKILEKK 329
162329403 294 LANWtpEKKKENLEGRAILYREKYNYLEIAKMWEKIL--- 330
162329333 294 LADWtpEKKKENLEGRAILYRERYNYLEIAKMWEKIL--- 330
171473691 294 LANWslDKKKENLENRAVLYRERYSYLNMAKEWEKIL--- 330
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap