Conserved Protein Domain Family
PHA01625

?
PHA01625: PHA01625 
hypothetical protein
Statistics
?
PSSM-Id: 164860
View PSSM: PHA01625
Aligned: 4 rows
Threshold Bit Score: 353.771
Threshold Setting Gi: 22122267
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22122321   1 MEVKQIKKLNNLPWVFLDTYLNKFALDKNFVNCAYYSSRSGMTQEGCVqvmqvgdnFKVDTMREVHGIYFTPHASIISLI 80 
16753103   9 LEVKQLKLLYNLPKVFLTPNLNKFSITRNYVDCAYYESRSGLTREGCI--------IFDGNVHRTRGIYYIPVPSAVELS 80 
22122268   4 VEVSVRKKLNNLPKVFLDIYLNKFTLDKNYINCVHYVSRSGLTQEGCVtgytvgsmLKIDTLKEVKGIYYVPHPSIINIT 83 
22122267   1 MEIKERKKLDYLPNVFLLPDGNKISVTDKFINCEKYISRSRLTFQGCFevsilenkIKVDKAKETNGIYYTPNPPIFNIT 80 
22122321  81 YRQKGIRSIDDLKEILGSLNLSKVSPKHYQLLVKYSNYTIEIYDIYFKGHIYEFPLVS----QQGHLNVYNVPEPRNVYL 156
16753103  81 YRRKMIKDEQDVKQIIEKINLYGATLNTNKLLVKWNNYEIILYDRFIKGGMYEFPLLF----SQGHLYVYNIPRVREAYR 156
22122268  84 FRQKAIRNLDDLKQFLMSLDVSKISPRQPWLLVKYSNYSIEVFDIYFKGLIYEFPLLA----EQGHLRIYSVPEPKDVYL 159
22122267  81 FKQKIFRKINDIKSMLINLDLSKVSLKSSSIIIKYDNYSIQLFDIYYKGEKLEFSPAFypdgKQGHLSVYEVPPLK---- 156
22122321 157 IYYENNEEKKELNKDLFNEVSEFMIYNHRVTFEKPVLEFKNLQITPGGGALVYVPESMYVKLESSDHQSVEFRPSRDDWL 236
16753103 157 IIYENDNQKEEIDSEMFEEINEFSVYNHAIKFDKKVLKLKELYVSPGQGVVIYTLDDVTLVSESPDHNKIEKFVYKNSWI 236
22122268 160 LYYDNDGQKREINKELFTEVSEFMIFNHKVTFDKSILMFKNLYVTPGSGTLLYVPEDVHVKLESSDHKEVEVNVNRDTWL 239
22122267 157 --------IEKINEELFEKTRIIGIYNHIIEFDINVLKYKQLHIMPGEGALVYLPEPPVVKIISPEHDNVGFTEFGGKWL 228
22122321 237 LFSHPRPR-RSGND 249
16753103 237 LFSHRAPRnQDQRD 250
22122268 240 LFSHTRPR-RSGQD 252
22122267 229 LFSHPVPK-KNPKD 241
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap