Conserved Protein Domain Family
PHA01622

?
PHA01622: PHA01622 
CRISPR-associated Cas4-like protein
Statistics
?
PSSM-Id: 164858
View PSSM: PHA01622
Aligned: 3 rows
Threshold Bit Score: 326.162
Threshold Setting Gi: 22122239
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
159341075   1 MVYAEKVKESFMRQYPIGTLFPSEIGICVRKSVLARRVTFKKMMGTESTDAGASIHVTVQQYFTATMNCEAEKPVSYNID 80 
22122292    4 MNYEDHIKESFKVKYPNDTLFPSEVGICYRKSYLARNIEFERGINEIYLDLGEQYHERIEQYFKEKLNCQTEVEIKDEIE 83 
22122239    4 MNYEDHIKESFKVKYPADTIFPSEVGICYRKSYLARNIEFERGINEIYLDLGEQYHERIEQYFKEKLNCQTEVEIKDEIE 83 
159341075  81 GITISGKVDLLCNNDLIELKTTGKTVFTPYANHLMQIAVYRQALKTMGIDVKGTYIVYINRAIDDVQEFHISESQLQTAL 160
22122292   84 GMKISGRIDIVCGNDLLEIKTISYNYFQVKEYHLYQVALYYHILKKQNYQINNVYIIYLNRNTREVKQFKIDEKVLETYY 163
22122239   84 GIKISGRIDIVCNNDLLEIKTISYNYFQVKEYHLYQVALYYHILKKQNYQINNVYIVYLNRNTREVKQFKIDEKVLENYY 163
159341075 161 KQAEDYVRRYNAFKDEKNIKNIPRGDVVFCQHCEFRSICfgdITRFF 207
22122292  164 QKVIEWIKKFKEYLKETDYKKVPGVNNYICKSCEFKQKC---IISLF 207
22122239  164 QKVIEWIKKFKEYLKETDYKKVPGVNNYICKSCEFKQKC---IISLF 207
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap