Conserved Protein Domain Family
PHA01547

?
PHA01547: PHA01547 
putative internal virion protein A
Statistics
?
PSSM-Id: 177311
View PSSM: PHA01547
Aligned: 8 rows
Threshold Bit Score: 206.815
Threshold Setting Gi: 281306692
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
158345180   1 MALPALLAIGGLSAAQGIFGGLQQRQQIKAQNKLTKEANRRNVLEAFQGVSAIEVQRGQVRTQTAKNLQLAGRMADEVRG 80 
33300846    2 AFWLPLLAAGGMSALQQGLANKEERNKIKAENKARLKTDLDNLGAAARDIANLGVMAASYRKQAVASQVEAKRQGMLAGG 81 
158345062   2 AFWLPLLAAGGMSALQQGLANKEERNKIKAENKARLKADLDNLGAAARDIANLGVMAASYRKQAVASQVGAKRQGMLAGG 81 
167600481   2 AFWLPLLAAGGMSALQQGLANKEERNKIKAENKARLKTDLDNLGAAARDIANLGVMAASYRKQAVASQVEAKRQGMLAGG 81 
195546742   2 AFWLPLLAAGGMSALQQGLANKEERNKIKAENKARLKTDLDNLGAAARDIANLGVMAASYRKQAVASQVEAKRQGMLAGG 81 
195546680   2 AFWLPLLAAGGMSALQQGLANKEERNKIKAENKARLKTDLDNLGAAARDIANLGVMAASYRKQAVASQVEAKRQGMLAGG 81 
225626362   2 AFWLPLLAAGGMSALQQGLSNKEERRKIKAENKARLKTDLDNLGAAARDIANLGVMAASYRKQAVASQVEAKRQGMLAGG 81 
281306692   1 -MWM-MLAQAAASGIKAKLDNDRRKKEIKAQNKAAKAADDRTIANAYQEVSSYNLQNGMLRVQAAKELQQADKMAYSAQG 78 
158345180  81 STRAAQAAAGVQGASVDATLDDIDREQAEVSVELQQQHIAQEYDLNNRIRELMLGTRAG-LGQLQKVPSIGSILLGGLvq 159
33300846   82 SAEAQAGAFGVKGASVDAVALDIEREVGEALIQIDDNLDNQMWNLAEQAHSIQAQAKAGlLGQKSTTAGQRSPLVAGL-- 159
158345062  82 TAASQAGAFGIKGASVDAVSLDIEREVGEALIQIDDDLDNKMWNLAEQAHSIQSQTKAGlLGQKSTTANQRSPLVAGL-- 159
167600481  82 SAEAQAGAFGVKGASVDAVALDIEREVGEALIQIDDNLDNQMWNLAEQAHSIQAQAKAGlLGQKSTTAGQRSPLVAGL-- 159
195546742  82 SAEAQAGAFGVKGASVDAVALDIEREVGEALIQIDDNLDNQMWNLAEQAHSIQAQAKAGlLGQKSTTAGQRSPLVAGL-- 159
195546680  82 SAEAQAGAFGVKGASVDAVALDIEREVGEALIQIDDNLDNQMWNLAEQAHSIQAQAKAGlLGQKSTTAGQRSPLVAGL-- 159
225626362  82 SASAQAGAFGVKGASVDAVALDIEREVGEALIQIDDNLDNQMWNLAEQAHSIQAQAKAGlLGQKSTTAGQRSPLVAGL-- 159
281306692  79 TVAANAAAAQVKGASVDAVINDIDRELGEARVATEQSLEAGQYNIQNSIRSVVQSASSAlLGQQNPYANQSSPLLATL-- 156
158345180 160 ggLSAGSAYASQAFSFGsfgststtggtygqsgvavagqagfrSGVGPGR 209
33300846  160 --MSAGSLYASQYFKFG--------------------------ATPKGGN 181
158345062 160 --MSAGSMYASQYFKFG--------------------------ATPKGGN 181
167600481 160 --MSAGSLYASQYFKFG--------------------------ATPKGGN 181
195546742 160 --MSAGSLYASQYFKFG--------------------------ATPKGGN 181
195546680 160 --MSAGSLYASQYFKFG--------------------------ATPKGGN 181
225626362 160 --MSAGSLYASQYFKFG--------------------------ATPKGGN 181
281306692 157 --STLGSSYLNNQMKFGggsgfsffgggtptpgtpaagtaetfAAPSSGG 204
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap