Conserved Protein Domain Family
PHA01519

?
PHA01519: PHA01519 
hypothetical protein
Statistics
?
PSSM-Id: 107039
View PSSM: PHA01519
Aligned: 4 rows
Threshold Bit Score: 150.033
Threshold Setting Gi: 46358681
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
46358681    1 MTMDYSQLSDFEINRMV----GDIIFKGLwackpetsgnntnKWYYGNADTTFEPLNHLP------DYCNDPSASWPIIE 70 
9635524     1 MTMDYSQLSDFEINKRVaiatGHKKFNGL-------------GWQGTQEDSCSAVIVRGPtkigafDPCNNPADAWPIIE 67 
24371569    1 MTMDYSQLSDFEINRMV----GDIIFKGLwackpetsgnntnKWYYGNADTTFEPLNHLP------DYCNDPSASWPIIE 70 
219681228   1 MTMDYSQLSDFEINRMV----GDIIFKGLwackpetsgnntnKWYYGNADTTFEPLNHLP------DYCNDPSASWPIIE 70 
46358681   71 KHRISILDQLTEWCVDAKGVSPIFDTRPLRAAMIVFLMMQDANNA 115
9635524    68 KYRISFLDQLTEWCVDAKGVSPIFDIRPLRAAMIVFLLMQDANNA 112
24371569   71 KHRISILDQLTEWCVDAKGVSPIFDTRPLRAAMIVFLMMQDANNA 115
219681228  71 KHRISILDQLTEWCVDAKGVSPIFDTRPLRAAMIVFLMMQDANNA 115
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap