Conserved Protein Domain Family
PHA01516

?
PHA01516: PHA01516 
hypothetical protein
Statistics
?
PSSM-Id: 107038
View PSSM: PHA01516
Aligned: 4 rows
Threshold Bit Score: 186.322
Threshold Setting Gi: 119952195
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
119952195   5 NRLRVWHIPQVPGKAFYVEVDSVEEGVRIIDILANYDLFQYENNIKGDYCNVSGLQMYDEHITDDEMEEMGLTDRWVDWY 84 
46358664    1 MKLRVWHIPQVPMKPFIVEVASVEEGVRVMDALADYDAFQYDNNIKPDYCNANGLEMWDESLTDQDLEEMELTDRWVDWY 80 
24371553    1 MKLRVWHIPQVPMKPFIVEVASVEEGVRVMDALADYDAFQYDNNIKPDYCNANGLEMWDESLTDQDLEEMELTDRWVDWY 80 
9635509     1 MKLRVWHIPQVPMKPFIVEVGSVEEGVRMMDALADYDAFQYDNNIKPDYCNANGLQMFDESLTDQDLEDMELDDRWIDWY 80 
119952195  85 yeDDQNFFDNPKEYLNNLKK 104
46358664   81 --SECQCYDDPREYIESLKE 98 
24371553   81 --SECQCYDDPREYIESLKE 98 
9635509    81 --SECQCYDDPREYLESLKE 98 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap