Conserved Protein Domain Family
PHA01514

?
PHA01514: PHA01514 
O-antigen conversion protein C
Statistics
?
PSSM-Id: 107037
View PSSM: PHA01514
Aligned: 3 rows
Threshold Bit Score: 810.361
Threshold Setting Gi: 24371535
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
24371535   1 MKFNSNDRIFISIFLGLAIIYTFPLLTHQSFFVDDLGRSLYGGLGWSGNGRPLSDFIFYIINFGTPIIDASPLPLMLGIV 80 
51236725   2 VKFNSNDRIFISIFLGLAIIYTFPLLTHQSFFVDDLGRSLYGGLGWSGNGRPLSDFIFYIINFGTPIIDASPLPLMLGIV 81 
46358649   1 MKFNSNDRIFISIFLGLAIIYTFPLLTHQSFFVDDLGRSLYGGLGWSGNGRPLSDFIFYIINFGTPIIDASPLPLMLGIV 80 
24371535  81 ILALALSCIREKLFGDDYITASLCFMMILANPFFIENLSYRYDSLTMCMSVAISIISSYVAYQYKPINIIISSILTIAFL 160
51236725  82 ILALALSCIREKLFGDDYITASLCFMMILANPFFIENLSYRYDSLTMCMSVAISIISSYVAYQYKPINIIISSILTIAFL 161
46358649  81 ILALALSCIREKLFGDDYITASLCFMMILANPFFIENLSYRYDSLTMCMSVAISIISSYVAYQYKPINIIISSILTIAFL 160
24371535 161 SLYQAALNTYAIFLLAFIISDVVKKNSISNITKNTASSVAGLIVGYFAYSYFIAKRLVTGSYNIEHSKIIEINSSLFEGI 240
51236725 162 SLYQAALNTYAIFLLAFIISDVVKKNSISNITKNTASSVAGLIVGYFAYSYFIAKRLVTGSYNIEHSKIIEINSSLFEGI 241
46358649 161 SLYQAALNTYAIFLLAFIISDVVKKNSISNITKNTASSVAGLIVGYFAYSYFIAKRLVTGSYNIEHSKIIEINSSLFEGI 240
24371535 241 ISNVLSFYRMFSTILNGDNYLIYYSLFFALIISLIVIVLKVIKRDENKKTKFLLVVLILLASMFFIIGPMIFLKSPIYAP 320
51236725 242 ISNVLSFYRMFSTILNGDNYLIYYSLFFALIISLIVIVLKAIKRDENKKTKLLLVVLILLASMFFIIGPMIFLKSPIYAP 321
46358649 241 ISNVLSFYRMFSTILNGDNYLIYYSLFFALIISLIVIVLKVIKRDENKKTKFLLVVLILLASMFFIIGPMIFLKSPIYAP 320
24371535 321 RVLIGMGGFMFFCCLCVFYAFEDKQLISRIYFSFILLISTIFSYGAYNAINAQFQLEESIVNRISQDIDHLGFGRDKKNI 400
51236725 322 RVLIGMGGFMFFCCLCVFYAFEDKQLISRIYFSFILLISTIFSYGAYNAINAQFQLEESIVNRISQDIDYLGFGRDKKNI 401
46358649 321 RVLIGMGGFMFFCCLCVFYAFEDKQLISRIYFSFILLISTIFSYGAYNAINAQFQLEESIVNRISQDIDHLGFGRDKKNI 400
24371535 401 KFIGTEPYASINENIVIKHPLMRELIPRIINNNWMWSEVLMQRNVFSRNYRLYDKEVKLENGWKKSGNNVYDIGVVGETI 480
51236725 402 KFIGTEPYAPINENIVIKHPLMRELIPRIINNDWMWSEVLMQRNVFSRNYRLYDKEVKLENGWKKSGNNVYDIGVVGETI 481
46358649 401 KFIGTEPYASINENIVIKHPLMRELIPRIINNNWMWSEVLMQRNVFSRNYRLYDKEVKLENGWKKSGNNVYDIGVVGETI 480
24371535 481 VVRFN 485
51236725 482 VVRFN 486
46358649 481 VVRFN 485
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap