Conserved Protein Domain Family
mnt

?
PHA01513: mnt 
Mnt
Statistics
?
PSSM-Id: 164855
View PSSM: PHA01513
Aligned: 5 rows
Threshold Bit Score: 150.131
Threshold Setting Gi: 46358711
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
46358711   1 MGRDDPQFNLRLPYELKEKVKQRAKANGRSLNAELVQIVADSLEKPTPVIGYRDDAEREADIVSREIQELVFEKLKDFYR 80 
24371596   1 MGRDDPQFNLRLPYELKEKVKQRAKANGRSLNAELVQIVADSLEKPTPVIGYRDDAEREADIVSREIQELVFEKLKDFYR 80 
9635548    1 MARDDPHFNFRMPMEVREKLKFRAEANGRSMNSELLQIVQDALSKPSPVTGYRNDAERLADEQSELVKKMVFDTLKDLYK 80 
219681257  1 MGRDDPQFNLRLPYELKEKLKQRAKSNGRSLNAELVQIVTEAISKPSPVSGYRDEAERIADEQSELVKKMVFDTLKSLYK 80 
221328634  1 MARDDPHFNFRMPMEVREKLKFRAEANGRSMNSELLQIVQDALSKPSPVTGYRDDAERLADEQSDLVKKMVFDTLKDLYK 80 
46358711  81 KK 82 
24371596  81 KK 82 
9635548   81 KT 82 
219681257 81 KT 82 
221328634 81 KP 82 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap