Conserved Protein Domain Family
PHA01511

?
PHA01511: PHA01511 
coat protein
Statistics
?
PSSM-Id: 107035
View PSSM: PHA01511
Aligned: 6 rows
Threshold Bit Score: 851.366
Threshold Setting Gi: 219681246
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9635538     1 MALNEGQIVTLAVDEIIETISAITPMAQKAKKYTPPAASMQRSSNTIWMPVEQESPTQEGWDLTDKATGLLELNVAVNMG 80 
46358700    1 MALNEGQIVTLAVDEIIETISAITPMAQKAKKYTPPAASMQRSSNTIWMPVEQESPTQEGWDLTDKATGLLELNVAVNMG 80 
24371587    1 MALNEGQIVTLAVDEIIETISAITPMAQKAKKYTPPAASMQRSSNTIWMPVEQESPTQEGWDLTDKATGLLELNVAVNMG 80 
219681246   1 MALNEGQIVTLAVDEIIETISAITPMAQKAKKYTPPAASMQRSSNTIWMPVEQESPTQEGWDLTDKATGLLELNVAVNMG 80 
221328623   1 MALNEGQIVTLAVDEIIDTISAITPMAQKAKKYTPPASSMQRSSNTIWMPVEQESPTQEGWDLTDKATGLLELNVAVNMG 80 
255252687   1 MALNEGQIVTLAVDEIIDTISAITPMAQKAKKYTPPASSMQRSSNTIWMPVEQESPTQEGWDLTDKATGLLELNVAVNMG 80 
9635538    81 EPDNDFFQLRADDLRDETAYRRRIQSAARKLANNVELKVANMAAEMGSLVITSPDAIGTNTADAWNFVADAEEIMFSREL 160
46358700   81 EPDNDFFQLRADDLRDETAYRHRIQSAARKLANNVELKVANMAAEMGSLVITSPDAIGTNTADAWNFVADAEELMFSREL 160
24371587   81 EPDNDFFQLRADDLRDETAYRHRIQSAARKLANNVELKVANMAAEMGSLVITSPDAIGTNTADAWNFVADAEELMFSREL 160
219681246  81 EPDNDFFQLRADDLRDETAYRHRIQSAARKLANNVELKVANMAAEMGSLVITSPDAIGTNTADAWNFVADAEELMFSREL 160
221328623  81 EPDNDFFQLRADDLRDETAYRHRIQSAARKLANNVELKVANMAAEMGSLVITSPDAIGTNTADAWNFVADAEELMFSREL 160
255252687  81 EPDNDFFQLRADDLRDETAYRHRIQSAARKLANNVELKVANMAAEMGSLVITSPDAIGTNTADAWNFVADAEELMFSREL 160
9635538   161 NRDMGTSYFFNPQDYKKAGYDLTKRDIFGRIPEEAYRDGTIQRQVAGFDDVLRSPKLPVLTKSTATGITVSGAQSFKPVA 240
46358700  161 NRDMGTSYFFNPQDYKKAGYDLTKRDIFGRIPEEAYRDGTIQRQVAGFDDVLRSPKLPVLTKSTATGITVSGAQSFKPVA 240
24371587  161 NRDMGTSYFFNPQDYKKAGYDLTKRDIFGRIPEEAYRDGTIQRQVAGFDDVLRSPKLPVLTKSTATGITVSGAQSFKPVA 240
219681246 161 NRDMGTSYFFNPQDYKKAGYDLTKRDIFGRIPEEAYRDGTIQRQVAGFDDVLRSPKLPVLTKSTATGITVSGAQSFKPVA 240
221328623 161 NRDMGTSYFFNPQDYKKAGYDLTKRDIFGRIPEEAYRDGTIQRQVAGFDDVLRSPKLPVLTKSTATGITVSGAQSFKPVA 240
255252687 161 NRDMGTSYFFNPQDYKKAGYDLTKRDIFGRIPEEAYRDGTIQRQVAGFDDVLRSPKLPVLTKSTATGITVSGAQSFKPVA 240
9635538   241 WQLDNDGNKVNVDNRFATVTLSATTGMKRGDKISFAGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVALDDVSL 320
46358700  241 WQLDNDGNKVNVDNRFATVTLSATTGLKRGDKISFTGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVALDDVSL 320
24371587  241 WQLDNDGNKVNVDNRFATVTLSATTGLKRGDKISFTGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVALDDVSL 320
219681246 241 WQLDNDGNKVNVDNRFATVTLSATTGLKRGDKISFTGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVALDDVSL 320
221328623 241 WQLDNDGNKVNIDNRFATVTLSATTGLKRGDKISFTGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVALDDVSL 320
255252687 241 WQLDNDGNKVNIDNRFATVTLSATTGLKRGDKISFTGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVALDDVSL 320
9635538   321 SPEQRAYANVNTSLADAMAVNILNVKDARTNVFWADDAIRIVSQPIPANHELFAGMKTTSFSIPDVGLNGIFATQGDIST 400
46358700  321 SPEQRAYANVNTSLADAMAVNILNVKDARTNVFWADDAIRIVSQPIPANHELFAGMKTTSFSIPDVGLNGIFATQGDIST 400
24371587  321 SPEQRAYANVNTSLADAMAVNILNVKDARTNVFWADDAIRIVSQPIPANHELFAGMKTTSFSIPDVGLNGIFATQGDIST 400
219681246 321 SPEQRAYANVNTSLADAMAVNILNVKDARTNVFWADDAIRIVSQPIPANHELFAGMKTTSFSIPDVGLNGIFRTQGDIST 400
221328623 321 SPEQRAYANVNTSLADAMAVNILNVKDARTNVFWADDAIRIVSQPIPANHELFAGMKTTSFSIPDVGLNGIFATQGDIST 400
255252687 321 SPEQRAYANVNTSLADAMAVNILNVKDARTNVFWADDAIRIVSQPIPANHELFAGMKTTSFSIPDVGLNGIFATQGDIST 400
9635538   401 LSGLCRIALWYGVNATRPEAIGVGLPGQTA 430
46358700  401 LSGLCRIALWYGVNATRPEAIGVGLPGQTA 430
24371587  401 LSGLCRIALWYGVNATRPEAIGVGLPGQTA 430
219681246 401 LFRLCRIALWYGVNATRPEAIGVGLPGQTA 430
221328623 401 LSGLCRIALWYGVNATRPEAIGVGLPGQTA 430
255252687 401 LSGLCRIALWYGVNATRPEAIGVGLPGQTA 430
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap