Conserved Protein Domain Family
PHA01474

?
PHA01474: PHA01474 
nonstructural protein
Statistics
?
PSSM-Id: 164854
View PSSM: PHA01474
Aligned: 4 rows
Threshold Bit Score: 80.1816
Threshold Setting Gi: 47566143
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
77020119  1 MWRIYESRTTYEHSRFSSFWSCARIILSPWNSFRSFRISWCTKAKCHCEANC 52 
17402857  1 MWRIYESRTTYEHSRFSSFWSCSRIILSPWNSFRSFRISWRTETKCDCEANC 52 
47566143  1 MWRIYESRTTYEYSRFSSFWSCARIILSPWNSFRSFRISWCTKAKCDCEANC 52 
9634951   1 MWRVYESRTTYEYSRFSSFWSCPRIILSPWNSFWSFRISWRTETKCDCEANC 52 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap