Conserved Protein Domain Family
PHA01399

?
PHA01399: PHA01399 
membrane protein P6
Statistics
?
PSSM-Id: 133949
View PSSM: PHA01399
Aligned: 2 rows
Threshold Bit Score: 194.472
Threshold Setting Gi: 22855200
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22855223   1 MGFFKSIKKAIKSVVKAVVKVVKAVVKAIVSVIKAVVKLIKKIVSVILDFISKIFSNIGVILLLILLVIFawFLFPAFAA 80 
22855200   1 MGLFKSLKKLVKKVVDVVVKVVKKVVDLVVKAIKAIVKIIKKIVSVIMSFISKIFSKIGIILIIILIILA--FFFPAIWA 78 
22855223  81 FLQSAWAWIVNIFSTGWAWVVKTAGAAWQAITSFASTAWGYITAAWEWIAGAVGFIWKGLSGAADAVWEAAKELGSAAGG 160
22855200  79 FLQYLWASFVSFLQVAWTWVTQTLGAAWQAISSFASAAWGYVQAAWQWIAGAVAALWKGAGAVAGAAWEAAKELGSAAGG 158
22855223 161 VLSGVWDFIKENPELIAGGAALAWLGKDGLILVGLGVAAYFLLK-SSGSKGGGRGEQKVVINTTGeayapspyrtGSGAP 239
22855200 159 VIGGIWDFIKDNPELVAGGLAAWWLGKDGLILAGLAVGAFFLLRsSSGGGGSGKGTQTVTVNTMG----------GQGAS 228
22855223 240 RI 241
22855200 229 TA 230
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap