Conserved Protein Domain Family
PHA01351

?
PHA01351: PHA01351 
putative minor structural protein
Statistics
?
PSSM-Id: 107029
View PSSM: PHA01351
Aligned: 3 rows
Threshold Bit Score: 1695.52
Threshold Setting Gi: 159341086
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22122311     1 MFIILKRNILINMSFLVNLGELGTFFADEIENLENFTNWISSDFINFINAIVNDIKNIASFLGQAISDIPTFMTNIATNF 80  
22122257     1 MFIILKRNILINMSFLLNLGELGTFFADEIENLENFTNWISSDFINFINAIVNDIKNIASFLGQAISDIPTFMVNIATNF 80  
159341086    1 -----------MSGLIGDLTSLGTFFSDELGALENFVDFLATDFETFINSIASDFETFISYIATAVSDLATFAQTVYNDI 69  
22122311    81 LTILQNFVQTAISTIQGFVSWFEQQVVGAFEFLSSIASDFINSAYSFFQNVANAFAQIISGVISDFLNFFGANMKHIANA 160 
22122257    81 LTILQNFVQTAISTIQGFVSWFEQQIVGAFEFLSSIASDFINSAYSFFQNVANVFAQIISGVISDFLNFFGANMKHISNA 160 
159341086   70 VSALQNIASAIYPVLRNIGGIIAGAIETALGDLAQFAIDATGALANAIRTITNDIGSLLGTFISDAFQALGNIPLHISPF 149 
22122311   161 ISQLTQFLSPFIAPITIGKFLPVIVDKLAEILPEVEIDLAPVGLGGKIPIKFGEIIKAFAETSVDFLNEIRIELATTLKE 240 
22122257   161 ISQLSQFLSPFIAPITIGKFLPVIVDKLAEILPEIEIDLAPVGLGGKIPIKFGEIIKAFAETSVDFLNEIRTELATTLKE 240 
159341086  150 LAKASTFLASVISPYLIIRALPPAIDKLAELLPDFTISLAPVGLGARFEVKLGEIVKMFGENAADFMKDVSDEMMSTFKE 229 
22122311   241 FIKEPFISDFKISAREIFNEIGLGDLPFADPPFQLIGRWVAVRSFEEVKDHLKETILLTGYPAWFTDAYLESPTNDFLPR 320 
22122257   241 FIKEPFISDFKISAREIFNEIGLGDLPFADPPFQLIGRWVAVRSFDEVKDHLRETILLTGYPAWFTNAYLESPVNDFVPK 320 
159341086  230 FIKEPFISNFKIQVREIFNDIGLGDIPFADPSFTQIAKWVGARSFNEIKDHLKETVLLTGYAQWFTDAYLQPPVNDFVPQ 309 
22122311   321 NPLFRPVGIRDLILGTQYGILNISDLEKYAYNNLITPKTAKLMYQNQTARLLQRTVEQGIRQFIVTPQKAYEEIIQNINL 400 
22122257   321 NPLFRPVGIRDLITGSQYGILNISDLEKYAYNNLITPKTAKLMYQNQTARLLQRAVEQGIRQFVITPQKAYEEIISNINL 400 
159341086  310 NPLFKPVAIKDVITAVEYGILPADAVGKYAENNLITQKTATLMYQNQNLKLFQRVVEQGIRAFVVEPDKAYQLMTSGVSL 389 
22122311   401 TGKELFLKTFTLEYEYAVQRIVRQFLRSLLSRALSNFGRPYLDFKYLDDTIAKLFKDLGYPEEVRTVFDTMITQSQLIYT 480 
22122257   401 TGKELFLKTFTLEYEYAVQRIVRQFLRSLLSRALSNFGKPYLDFKYLDNTIAKLFKDLGYPEEVRTVFDTMITQSQLIDT 480 
159341086  390 SGRDLFTKYFDIEYQFATQRFAKQVLRSLLSRALSNFGRPYIDIQYLSSTTSKIFKELNLPTAIDNLFKEMMSQSQLIQY 469 
22122311   481 NQLLLRQLQQIVRLGIFDQKKIKEELKANKFNEQVALQILESELQFAQLQNILKEYQFKLRNFLISPRDLEKDLKHIGFD 560 
22122257   481 NQLLLRQLQQIVKLGIFNEKKIKEELKANKFNEQVALQILESELQFAQLQNTLKEYQFKLKSFLISPKDVEKDLKHLGFD 560 
159341086  470 NQLIYGLLRSEASMGIFDQQKVNELLQSHNFNVAETEYLLAHYANIAVMKEQLSVLKAKANNFFISDQDLGKELTSLGFT 549 
22122311   561 SAIISALIYENQVEQLIKFQLSNIESLAKKGYLSLDEIKKQFKAIGIIKEYEDAFINFVNQELQISAFLTILKSQLRQFQ 640 
22122257   561 SAIISALIYENQVEQLIKFQLTNIESLAKKGYLSLDEIKKQFKAIGIIKEYEDAFINFINQELQISAFLTILKSQLRQFQ 640 
159341086  550 PEYIQAFAEENFTLPLRKEIANVYLSLLRKGYYDVKEAKSIFGGLGYEKSVIEQLTNVYSTEIETELAIKTIQQKAQLFL 629 
22122311   641 IDPKIAEVELKKLNINEYLLNQIIQEEYNINIAKLQLSVLETIAKTLYYDQQQ--------------------------- 693 
22122257   641 IDPKVAEAELKKLNINEYLSNQIIQEEYNINIAKLHLSVLETIAKTLYYDQQQ--------------------------- 693 
159341086  630 LSQQEIITELKKLQVSDALANEITVEYFAIPLLKQQISVYESLIKKGYLNTDDakkvftslgyrqsvvdqliplyateit 709 
22122311   694 ---------------------LSGELGKIVKDKTALDLYIQKFYYEYIYPKIINYHLQLARHGILS-------------D 739 
22122257   694 ---------------------LSGELEKIIKDKTALELYIKKFYYEYIYPKIVNYHVQLARHGILS-------------D 739 
159341086  710 adatiakyksllqhfavnvktAEQELKQLHISSSLIEQILTEYYQVPLIEKLSAIYLSMLEKGYITidvlkkvlgpqniD 789 
22122311   740 ISKLPKEVVDYELKPAILTYQTTLEIEYIKESLKDLEIKPDNAINELEKLGMQKDIAQLIVNTYIPTFYSIHTIIQNIIE 819 
22122257   740 ISKLPKEVIDYEIKPALLTYQTTLEIEYIKESLKDLEIKPTDAINELEKLGMQKDIAQLIVNTYIPTFYNVHTIIQNIIE 819 
159341086  790 VSAITEIANAYNYEITVAN-----EIKYVQSLLRNLLIDEKTAEQELKKLNVSDSLVKAIVAESTPVVVSPKTVAQTLIE 864 
22122311   820 GQLYKIGKVPINLGNAESELRKLGIPDSQIKVLLEQYASTFGLEIWRRHLPSLSIIENAIKYNYLDQKLIEYSFIPSELL 899 
22122257   820 GQLYKVGKVPINLGNAESELRKLGIPDSQIKILLDQYSTTFGLDIWRKHLPSISIIENAIKYNYLDQKLIEYSFIPSELL 899 
159341086  865 GAIYHIQKVPVSVSHVIGELKKLNIPDSQVNALIDEIESQIALDIWKKYLPTLSDIESALTYGYPTEKLVQLSLIPAELL 944 
22122311   900 NLYTSYYQHLLVAQEVQSFKSEYITALIYNYQNLQLESLLKQYGINEALLNVMKLFAQVRKVVTGLQELYLTPSKALSIS 979 
22122257   900 NLYINYYQHLLVGQEVQSFKSEYITALIYNYQNLQLENLLKQYGINEALLSVIKLFAQVRKIVLGLQELYLTPTKALSIS 979 
159341086  945 NIHVNLTQHEMVGKEVQSLKSAYVKLLTYGIANAQLESLMRQYGVNDQLLSVLRLQAQLEKILTTYQELYLTPSKAISLS 1024
22122311   980 EYVSNPQQLLQKVFSEFQIPQELQNTYFEYARNRRVSRYVNEIITTINLLFEKQKIDLNTAQSYLQQLKKYGLTDEEIQL 1059
22122257   980 EYVSNPQQLLQKVFTEFQIPQELQNTYFEYARNRRVSRYVNEIITTINLLFEKHKIDLGTAQSYLQQLKKYGLTDEEIQL 1059
159341086 1025 EYLSNPTQTLQKVFADYQVPSDLQQIYMEYTRNRRLRTYISQIVETISLLFERHKITLDQAVQYLQQFKQYGLTDEEIQL 1104
22122311  1060 ITLNWQLRSAY 1070
22122257  1060 IILNWQLRSAY 1070
159341086 1105 IKLNWQLREMY 1115
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap