Conserved Protein Domain Family
PHA01346

?
PHA01346: PHA01346 
hypothetical protein
Statistics
?
PSSM-Id: 164853
View PSSM: PHA01346
Aligned: 3 rows
Threshold Bit Score: 73.5297
Threshold Setting Gi: 89888660
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9625358    1 MKHVNTLLMQELRLLICELKRLRLSAVSDPDFSQEKIHAELDSLLCKLSRHFD 53 
89888660   1 MKHVNTLLMQELRLLICELKRLKLSAVSDPDFSQEKIHAELDSLLRKLSRYFD 53 
242346745  6 MKHVNTLLMQELRLLICELKRLRLSAVSDPDFSQEKIHAELDSLLRKLSRHFD 58 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap