Conserved Protein Domain Family
PHA01083

?
PHA01083: PHA01083 
hypothetical protein
Statistics
?
PSSM-Id: 164851
View PSSM: PHA01083
Aligned: 3 rows
Threshold Bit Score: 267.648
Threshold Setting Gi: 9635476
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9635476    1 MYTNKLLDAYKDKMNYVQYKQIAHDLGVSPQMITEVRKG-RtFLNENQILMLADAVGEDKEKALIGLAMDKAKTHEAQTL 79 
30039754   1 MYANELLDAYKKAKNYVQDKQIAHDLNLSPQKISKMRTGvR-YISDEEAIFLAESAGIDPEIALLGCHADRNENPRIKAI 79 
18071299   1 --MQKTVRTLQKAKTRSKTSKLHTTRTCRPQKISKMRTGvRgYISDEEAIFLAESAGIDPEIALLGCHADRNENPRTKAI 78 
9635476   80 WQNIGKKFNGLGLSSISMACAGLALVIASPQEPLYQCALWALMLNAIAYAYPIKCLSFEGQFNEVSRND 148
30039754  80 WESIAKKQNGLGLRTISMLCGGLAVSISQFNEAVSYFALCRLMVKVAINSNAYKTSAFGSFINESKRND 148
18071299  79 WESIAKKQNGLGLRTISMLCGDLAVSISQFNEAVSYFAVCRLMVKVAIN-NAYKTSAFGSFINESKRND 146
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap