Conserved Protein Domain Family
PHA01081

?
PHA01081: PHA01081 
putative minor coat protein
Statistics
?
PSSM-Id: 133945
View PSSM: PHA01081
Aligned: 5 rows
Threshold Bit Score: 145.407
Threshold Setting Gi: 49248535
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
49248535    1 MEWLVDLFNKLLVFLYQLLISLVNMLKDLFFWAVEQIMAMVNLLLSGVFSLFAPVDMSQYMTSIPPTVAWVMAAVGVPQC 80 
23455827    1 MDWVIDLFNKLIEFLYRLLITLIDMLKDVFLWLIDGVLSAVNLLLEKALSLIEPMDVSSYLTGIPSGAAWVISAIGIPQC 80 
18071307    1 MDWVIDLFNKLIEFLYRLLITLIDMLKDVFLWLIDGVLSAVNLLLEKALSLIEPMDVSSYLTGIPSGAAWVISAIGIPQC 80 
49248526    1 MEWLVDLFNKLLVFLYQLLISLVNMLKDLFFWAVEQIMAMVNLLLSGVFSLFAPVDMSQYMTSIPPTVAWVMAAVGVPQC 80 
238821379   1 MDWVIDLFNKLIEFLYRLLITLIDMLKDVFLWLIDGVLSAVNLLLEKALSLIEPMDVSPYLTGIPSGAAWVISAIGIPQC 80 
49248535   81 LSIILAAITVRLMLQLIPFTRLGS 104
23455827   81 LGMIMSAIIVRILFQLVPFTRLGS 104
18071307   81 LGMIMSAIIVRILLQLVPFTRLGS 104
49248526   81 LSIILAAITVRLMLQLIPFTRLGS 104
238821379  81 LGMIMSAIIIRILLQLVPFTRLGS 104
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap