Conserved Protein Domain Family
PHA01080

?
PHA01080: PHA01080 
hypothetical protein
Statistics
?
PSSM-Id: 164850
View PSSM: PHA01080
Aligned: 6 rows
Threshold Bit Score: 136.197
Threshold Setting Gi: 49248532
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
26114634   1 MPVCALPNSQGFLAVTDKPLNECDGGYVAVTIQDYDYLMSYTRITPTDAGLAFSFGFMAVFALGYLSTKALYVGKKLINL 80 
30039746   1 MPVCALPNSQGFLAVTDKPLNECDGGYVAFTIQDYDYLMSYTRITPTDAGTAFSFGFMAVFALGYLYTYAVYIGKKLINL 80 
49248532   1 MPVCALPNADGFLAVVPDIEAASCSGYVMVTAQEYDTLMSYTQLTPGEISQAFGLGFTLVFVGGYLSTYAIKMAIRLIKL 80 
49248523   1 MPVCALPNADGFLAVVPDIEAASCSGYVMVTAQEYDTLMSYTQLTPGEISQAFGLGFTLVFVGGYLSTYAIKMAIRLIKL 80 
23455837   1 MPVCALPNSQGFLAVTDKPLNECDGGYVAVTIQDYDYLMSYTRITPTDAGTAFSFGFMAVFALGYLYTYAVYIGKKLINL 80 
238821375  1 MPVCALPNSQGFLAVTDKPLNECDGGYVAVTIQDYDYLMSYTRITPTDAGTAFSFGFMAVFALGYLYTYAVYIGKKLINL 80 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap