Conserved Protein Domain Family
PHA01079

?
PHA01079: PHA01079 
hypothetical protein
Statistics
?
PSSM-Id: 164849
View PSSM: PHA01079
Aligned: 5 rows
Threshold Bit Score: 61.6456
Threshold Setting Gi: 29565741
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
31072025   4 EEHTNTIHNMTKDDFGISKLDKSNELNETMTIGQGKSQDEVTTALFNL 51 
29565741   1 MYEGNNMRSMMGTSYEDSRLNKRTELNENMSIDTNKSEDSYGVQIHSL 48 
66395207   1 MYEGNNMRSMMGTSYEDSRLNKRTELNENMSIDTNKSEDSYGVQIHSL 48 
157738606  1 MYEGNNMRSMMGTSYEDSRLNKRTELNENMSIDVNKSEDEYGVQIHSL 48 
29565764   1 MYEGNNMRSMMGTSYEDSRLNKRTELNENMSIDTNKSEDSYGVQIHSL 48 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap