Conserved Protein Domain Family
PHA01078

?
PHA01078: PHA01078 
putative upper collar protein
Statistics
?
PSSM-Id: 164848
View PSSM: PHA01078
Aligned: 5 rows
Threshold Bit Score: 385.936
Threshold Setting Gi: 31072023
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157738604   1 MILGYVnntyfnqapNFSSNFNFQFQKRLTKEDIYFIVPDYLIPDECLQIHKLYDncmsGNFVVMQNKPIQYNSDIEIIE 80 
31072023   83 DVLGYC---------SVNTNYLQPIKEPLQGKDITFIHNNILPKGKYKELTRYSD----GNFVVLRNKRASFLCDYNIIT 149
29565762    1 MILGYVnntyfnqapNFSSNFNFQFQKRLTKEDIYFIVPDYLIPDDCLQIHKLYDncmsGNFVVMQNKPIQYNSDIEIIE 80 
29565739    1 MILGYVnntyfnqapNFSSNFNFQFQKRLTKEDIYFIVPDYLIPDDCLQIHKLYDncmsGNFVVMQNKPIQYNSDIEIIE 80 
66395194   79 MILGYVnntyfnqapNFSSNFNFQFQKRLTKEDIYFIVPDYLIPDDCLQIHKLYDncmsGNFVVMQNKPIQYNSDIEIIE 158
157738604  81 HYTDELAEVVLSRFSLIMQAKFSKVFKSEINDESINQLVSEIYNGAPFVKMSPMFNAEDDIIDLTSNSVIPALTEMKREY 160
31072023  150 HYVMEMSEIANSRYSISIQAKVNTFIRNEGGSKDGQVMANNLFNGVPYTATTPKFDPEEHILTFNNASAVSFLPELKREQ 229
29565762   81 HYTDELAEVALSRFSLIMQAKFSKIFKSEINDESINQLVSEIYNGAPFVKMSPMFNADDDIIDLTSNSVIPALTEMKREY 160
29565739   81 HYTDELAEVALSRFSLIMQAKFSKIFKSEINDESINQLVSEIYNGAPFVKMSPMFNADDDIIDLTSNSVIPALTEMKREY 160
66395194  159 HYTDELAEVALSRFSLIMQAKFSKIFKSEINDESINQLVSEIYNGAPFVKMSPMFNADDDIIDLTSNSVIPALTEMKREY 238
157738604 161 QNKISELSNYLGINSLAVDKESGVSDEEAKSNRGFTTSNSNIYLKGR-EPITFLSKRYGLDIKPYYDDETTSKISMVDTL 239
31072023  230 QNKISELNAMLGLNTLGVDKESGVSEIEAQSNTAFKKANENIYLGIRnEALNLINNKYGLNIHAEYRDNMVAELSSIEKL 309
29565762  161 QNKISELSNYLGINSLAVDKESGVSDEEAKSNRGFTTSNSNIYLKGR-EPITFLSKRYGLDIKPYYDDETTSKISMVDTL 239
29565739  161 QNKISELSNYLGINSLAVDKESGVSDEEAKSNRGFTTSNSNIYLKGR-EPITFLSKRYGLDIKPYYDDETTSKISMVDTL 239
66395194  239 QNKISELSNYLGINSLAVDKESGVSDEEAKSNRGFTTSNSNIYLKGR-EPITFLSKRYGLDIKPYYDDETTSKISMVDTL 317
157738604 240 lkDESSDLNG 249
31072023  310 --QIVSEVAQ 317
29565762  240 fkDESSDING 249
29565739  240 fkDESSDING 249
66395194  318 fkDESSDING 327
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap