Conserved Protein Domain Family
PHA01076

?
PHA01076: PHA01076 
putative encapsidation protein
Statistics
?
PSSM-Id: 107017
View PSSM: PHA01076
Aligned: 5 rows
Threshold Bit Score: 568.859
Threshold Setting Gi: 157738595
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
29565730    1 MNDDIDYYISISNRSDGKSFNYVSFFIYLAIKLDIKFTLLSRHYTLRDAYRDFIEEIIDENPLFKSKRVTFRSARDYLAI 80 
31072014   46 CSDEILHYMSITSRGDGKSFNYIGALAWLSYHLNFGTMLLVRHWSLMDKMAEMVFEIIRTVGMFDIENVGIQAKADYLTI 125
66395192   38 MNDDIDYYISISNRSDGKSFNYVSFFIYLAIKLDIKFTLLSRHYTLRDAYRDFIEEIIDENPLFKSKRVTFRSARDYLAI 117
29565752    1 MNDDIDYYISISNRSDGKSFNYVSFFIYLAIKLDIKFTLLSRHYTLRDAYRDFIEEIIDENPLFKSKRVTFRSARDYLAI 80 
157738595   1 MNDDIDYYISISNRSDGKSFNYVSFFIYLAIKLDIKFTLLSRHYTLRDAYRDFIEEIIDKNPLFKSKRVTFRSARDYLAI 80 
29565730   81 IYQDKEIGVITDLNSATDLKYHSNFLKHYPIIIYDEFLALEDDYLIDEWDKLKTIYESIDRnHGNVDYIGFPKMFLLGNA 160
31072014  126 TIEGREVFIITNLNNASDLKQSSAVLRNYPVVLYDEFLTLGEDYVTNELAKLQTIIKSIDR-MGKRPYIKRPKIIYLGNP 204
66395192  118 IYQDKEIGVITDLNSATDLKYHSNFLKHYPIIIYDEFLALEDDYLIDEWDKLKTIYESIDRnHGNVDYIGFPKMFLLGNA 197
29565752   81 IYQDKEIGVITDLNSATDLKYHSNFLKHYPIIIYDEFLALEDDYLIDEWDKLKTIYESIDRnHGNVDYIGFPKMFLLGNA 160
157738595  81 IYQDKEIGVITDLNSATDLKYHSNFLKHYPIIIYDEFLALEDDYLIDEWDKLKTIYESIDRnHGNVDYIGFPKMFLLGNA 160
29565730  161 VNFSSPILSNLNIYNLLQKHKMNTSRLYKNIFLEMRRNDYVNEKRNTRAFNSNDDAMTTGEFEFNEYNLADDNLRNHINQ 240
31072014  205 VNFDSPILPALNIFYALQNQEINTIQQHGKTILELRRNDEVNEEKTTGYFEDSVDSDITGEFNFSNYRLADQQTYNKALT 284
66395192  198 VNFSSPILSNLNIYNLLQKHKMNTSRLYKNIFLEMRRNDYVNEKRNTRAFNSNDDAMTTGEFEFNEYNLADDNLRNHINQ 277
29565752  161 VNFSSPILSNLNIYNLLQKHKMNTSRLYKNIFLEMRRNDYVNEKRNTRAFNSNDDAMTTGEFEFNEYNLADDNLRNHINQ 240
157738595 161 VNFSSPILSNLNIYNLLQKHKMNTSRLYKNIFLEMRRNDYVNERRNTRAFNSNDDAMTTGEFEFNEYNLADDNLRNHINQ 240
29565730  241 NGDFFYIKTDDKYIKVMYNVTTfmTNIIVVPYTK-QYEFCTKIRDIDNHVTYLRDDMFYKENMERyyYNPSNLHFDNAYS 319
31072014  285 NGTLYKIRLEDKLSYVILESDN--EYILSIEESKlDENYCIHLKDETATCEYLKPSFYKDSFIKR--FQKGHFNFKDSFS 360
66395192  278 NGDFFYIKTDDKYIKVMYNVTTfmTNIIVVPYTK-QYEFCTKIRDIDNHVTYLRDDMFYKENMERyyYNPSNLHFDNAYS 356
29565752  241 NGDFFYIKTDDKYIKVMYNVTTfmTNIIVVPYTK-QYEFCTKIRDIDNHVTYLRDDMFYKENMERyyYNPSNLHFDNAYS 319
157738595 241 NGDFFYIKTDDKYIKIMYNVDTfnANIIVIPYTK-QYEFCTKIKDIDDNVIYLREDMFYKENMERyyYNPSNLHFDNAYS 319
29565730  320 KNYVVDNDRYLYLDMNKIikfhiknemkkNMSEFERKEKIYEDNYIENTKKYLMKQYGL 378
31072014  361 RTFIEGNEDLQRLNFFKL-----------NAVASTDHEDAYANIVRESWISRLAKIYEQ 408
66395192  357 KNYVVDNDRYLYLDMNKIikfhiknemkkNMSEFERKEKIYEDNYIENTKKYLMKQYGL 415
29565752  320 KNYVVDNDRYLYLDMNKIikfhiknemkkNMSEFERKEKIYEDNYIENTKKYLMKQYGL 378
157738595 320 KNYVVDNDRYLYLDMNKIikfhiknemkkNINEFERKEKIYEDNYIENTKKYLMKQYGL 378
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap