Conserved Protein Domain Family
PHA00979

?
PHA00979: PHA00979 
putative major coat protein
Statistics
?
PSSM-Id: 177310
View PSSM: PHA00979
Aligned: 3 rows
Threshold Bit Score: 72.3839
Threshold Setting Gi: 49248533
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
49248533 34 AADPFSAIDLSGVATKIGAAGLVIVGITMAYKSITLAKRAVNKA 77 
23455838  1 MADIFGAIDFAGVAALVTAAGVSIIGITMAFKGISLGKRAVNKA 44 
49248524 34 AADPFSAIDLSGVATKIGAAGLVIVGITMAYKSITLAKRAVNKA 77 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap