Conserved Protein Domain Family
PHA00821

?
PHA00821: PHA00821 
hypothetical protein
Statistics
?
PSSM-Id: 164843
View PSSM: PHA00821
Aligned: 3 rows
Threshold Bit Score: 517.363
Threshold Setting Gi: 38638608
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057651   1 MPTNTPITIPIANGVVSVPMAQGSKGQVEVQLFGPAPATGTLKVEGLQWTGTYQVLQGATAINLATALAGGGTIALTEHG 80 
38638608   1 MPTNTPITIPIANGVVSVPMAQGSKGQVEVQLFGPAPAAGTLKVEGLQWTGTYQVLQGATAINLATALAGGGTIALTEHG 80 
23752314   1 MPTNTPITIPIANGVVSVPMAQGGKGQVEVQLFGPAPATGTLKVEGLQWTGTYQVLQGATAINLATALAGGGTIALTEHG 80 
41057651  81 HYRALRFTFTGVTGSTGPLSGTAYVTDGTIADLAFQGLRALNVQGYVESNVKLGYQFYFQYMLPTIAGGGTNAVKIAFRT 160
38638608  81 HYRALRFTFTGVTGSTGPLSGTAYVTDGAIADLAFQGLRALNVQGYVESNVKLGYQFYFQYMLPTIAGGGTNAVKIAFRT 160
23752314  81 HYRALRFTFTGVTGSTGPLSGTAYVTDGAIADLAFQGLRALNVQGYVESNVKLGYQFYFQYMLPTIAGGGTNAVKIAFRT 160
41057651 161 AAQPVLIKDRALYALGNSVGLQLFKAPTGISGGTAIPVQNYNDIIPQTSTVTVLGGVTTTSNGTAWGDPTHIYGASQAGG 240
38638608 161 AAQPVLIKDRALYALGNSVGLQLFKAPTGISGGTAIPVQNYNDIIPQTSTVTVLGGVTTTSNGTPWGDPTHIYGANQAAG 240
23752314 161 AAQPVLIKDRALYALGNSVGLQLFKAPTGISGGTAIPVQNYNDIIPQTSTVTVLGGVTTTSNGTAWGDPTHIYGASQAGG 240
41057651 241 RTGSGLAPGADRVLAPNHDYLIVVTNLDTTTGTGGQALCDYYLTWYEGALDLPRQ 295
38638608 241 RTGSGLAPGADRVLAPNRDYLIVVTNLDTTTGTGGQALCDYYLTWYEGAPDLPRQ 295
23752314 241 RTGSGLAPGADRVLAPNHDYLIVVTNLDTTTGTGGQALCDYYLTWYEGALDLPRQ 295
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap