Conserved Protein Domain Family
PHA00781

?
PHA00781: PHA00781 
hypothetical protein
Statistics
?
PSSM-Id: 133939
View PSSM: PHA00781
Aligned: 3 rows
Threshold Bit Score: 99.7306
Threshold Setting Gi: 41057341
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
19343398  1 MVRVINLGKEKKFPITQELYERLESVIHDYdGEISLCEAIGTLELLKQSLIEGAKESSA 59 
41057341  1 MSRVINLGKEKKFPITQELYERLESVIHDY-GEISVCEAIGTLELLKQSLIESMKSQRP 58 
13559864  1 MSRVINLGKEKKFPITQELYERLESVIHDYdGEISLCEAIGTLELLKQSLIEGAKESST 59 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap