Conserved Protein Domain Family
PHA00780

?
PHA00780: PHA00780 
hypothetical protein
Statistics
?
PSSM-Id: 107010
View PSSM: PHA00780
Aligned: 8 rows
Threshold Bit Score: 108.171
Threshold Setting Gi: 46358693
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
46358693    1 MAEITALTELQQMNLDILRLVQSDTAAAEKAIAFVAGSKLNFELFKDQLVLAQGEGTALARAEKAIREAKEALDLFTAGA 80 
41057340    1 MAEIIPMTEEQKFQLEIYKLVMNQNAAAEEAFQFIGTDELKLELFKIHFQSGGANSDITTRTIEAVRKSKEALDLFTTGA 80 
13559863    1 MAEIIPMTEEQKFQLEIYKLVMNQNAAAEEAFQFIGTDELKLELFKIHFQSGGANSDITTRTIEAVRKSKEALDLFTTGA 80 
9635552     1 MAEIIPMTEEQKFQLEIYKLVMNQNAAAEEAFQFIGTDELKLELFKIHFQSGGANSDITTRTIEAVRKSREALDLFTTGA 80 
24371580   39 MAEITALTELQQMNLDILRLVQSDTAAAEKAIAFVAGSKLNFELFKDQLVLAQGEGTALARAEKAIREAKEALDLFTAGA 118
219681239  39 MAEITALTELQQMNLDILRLVQSDTAAAEKAIAFVAGSKLNFELFKDQLVLAQGEGTALARAEKAIREAKEALDLFTAGA 118
221328688   1 MAEIIPMTEEQKFQLEIYKLVMNQNAAAEEAFQFIGTDELKLELFKIHFQSGGANSDITTRTIEAVRKSKEALDLFTTGA 80 
255252748   1 MAEIIPMTEEQKFQLEIYKLVMNQNAAAEEAFQFIGTDELKLELFKIHFQSGGANSDITTRTIEAVRKSKEALDLFTTGA 80 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap