Conserved Protein Domain Family
PHA00771

?
PHA00771: PHA00771 
head assembly protein
Statistics
?
PSSM-Id: 164842
View PSSM: PHA00771
Aligned: 8 rows
Threshold Bit Score: 299.254
Threshold Setting Gi: 51236729
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
24371592    1 MITFTPTRNIDLIETVGNHPDIIAGSNNGDGYDYKPECRYFEVNVHGQFGGIVYYNEIQPLTFDCHAMYLPEIRGFSKEI 80 
51236729    1 MITFTPTRNIDLIEMVGNHPDIIAGSNNGDGYDYKPECRYFEVNVHGQFGGIVYYNEIQPMTFDCHAMYLPEIRGFSKEI 80 
46358706    1 MITFIPTRNIDLIETVGNHPDIIAGSNNGDGYDYKPECRYFEVNVHGQFGGIVYYNEIQPLTFDCHAMYLPEIRGFSKEI 80 
41057288    1 MIQFKPTRNIDLIEAVGNHPDIITGSNNGDGYDYKPECRYFEVNVHGQFGGIVYYQEIQPLTFDCHAMYLPEIRGFSKEI 80 
13559874    1 MITFKPTRNIDLIEAVGNHPDIIAGSNNGDGYDYKPECRYFEVSVHGQFGGIVYYQEIQPLTFDCHAMYLPEIRGFSKEI 80 
219681251   1 MITFTPTRNIDLIEMVGNHPDIIAGSNNGDGYDYKPECRYFEVNVHGQFGGIVYYNEIQPLTFDCHAMYLPEIRGFSKEI 80 
221328628   1 MITFTPTRNIDLIETVGNHPDIIAGSNNGDGYDYKPECRYFEVNVHGQFGGIVYYNEIQPLTFDCHAMYLPEIRGFSKEI 80 
255252692   1 MITFTPTRNIDLIETVGNHPDIIAGSNNGDGYDYKPECRYFEVNVHGQFGGIVYYNEIQPLTFDCHAMYLPEIRGFSKEI 80 
24371592   81 GLTFWRYILANTTVQCVTSFAARKFRHGQMYCAMIGLKRVGTIKKYFKGVDDVTFYSATREELIDFLNHGR 151
51236729   81 GLAFWRYILTNTTVQCVTSFAARKFRHGQMYCAMIGLKRVGTIKKYFKGVDDVTFYAATREELTELLNNGR 151
46358706   81 GLTFWRYILTNTTVQCVTSFAARKFRHGQMYCAMIGLKRVGTIKKYFKGVDDVTFYSATREELIDFLNHGR 151
41057288   81 GLAFWRYILTNTTVQCVTSFAARKFRHGQMYCAMIGLKRVGTIKKYFKGVDDVTFYSATREELIDFLNHGR 151
13559874   81 GLAFWRYILTNTTVQCVTSFAARKFRHGQMYCAMIGLKRVGTIKKYFKGVDDVTFYSATREELIDFLNHGR 151
219681251  81 GLAFWRYILTNTTVQCVTSFAARKFRHGQMYCAMIGLKRVGTIKKYFKGVDDVTFYAATREELIDFLNHGR 151
221328628  81 GLAFWRYILTNTSVQCVTSFAARKFRHGQMYCAMIGLKRVGTIKKYFKGVDDVTFYSATREELIDFLNHGR 151
255252692  81 GLAFWRYILTNTSVQCVTSFAARKFRHGQMYCAMIGLKRVGTIKKYFKGVDDVTFYSATREELIDFLNHGR 151
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap