Conserved Protein Domain Family
V3

?
PHA00739: V3 
structural protein VP3
Statistics
?
PSSM-Id: 177306
View PSSM: PHA00739
Aligned: 10 rows
Threshold Bit Score: 80.6374
Threshold Setting Gi: 270281849
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
42494964   1 MESNVKAVIFLFIFILIGVVLFQPIYNEVVYVTTSGTYTTYTTVsgtlTETTSSFIPNPQYVGSSNATVVSLVPVFYLLV 80 
9625544    1 MEISLKPIIFLVVFIIVGIALFGPINSVVNNVTTSGTYTTIVSG----TVTTSSFVSNPQYVGSNNATIVALVPLFYILV 76 
42495086   2 EEINVRQILFLAIFIVLGVVLFNPIISEVNYLTTPGTYTTIVSG----TLTTTSFVSNPQYVGSSNAPIVQLVPIFYLLV 77 
38639832   2 EELNIKQILFLAIFLVIGVVLFQPIISYVNNVTTSGTYTTIISG----TLTQTSFVSNPNYVGSSNAPLVSLVPLFYLIV 77 
160688422  2 EEVNLKQIIFLAIFLVIGVVLFQPIISYVNNITTSGTYTTIVSG----TVTTSSFVSNPQYVGSSNVTLVDLVPLFYLIV 77 
198449233  2 EEVNLKQILFLVIFDILGVVLFQPIISFVNNITTSGSYTTVVSG----TVTQTQFVSNPNYVGSSNAPLVSLVPLFYLIV 77 
270281783  3 FDADAKTIIGLFIFILIGIVFFSPIITYVNQVSSPGSYTTVG--------TTSSFVANPYYAGSAGATIASLVPIFYLLV 74 
270281850  2 EEVNLKQILFLAIFLVIGVVLFSPIISYVNNITTSGTYTTYATVsgtlTVTTSSFVSNPNYVGSSNAPLVSLVPLFYLLV 81 
270281849 16 GSINIGVLLGLFIFILIGIVLLPVITSQVNNLTSGTTPS----------------------VTGTNATLLNLVPLFYILV 73 
270281817  3 FDTNVKTIIALFIFILVGIVFFSPIITYVNQVSSPGSYTTVVSG----TITTSSFVSNPYYAGSSGAIIASLVPIFYLLA 78 
42494964  81 LIIVPAVIGYRLYKSE 96 
9625544   77 LIIVPAVVAYKLYKEE 92 
42495086  78 LIIVPAVGAYRIYKSE 93 
38639832  78 LIVVPAVVAYKIYKD- 92 
160688422 78 LIVVPAVIAYKIYKE- 92 
198449233 78 LIVVPAVIAYKIYKE- 92 
270281783 75 IIAVPAFVVYRMTRER 90 
270281850 82 LIVVPAVIAYKIYKSE 97 
270281849 74 LIIVPAVVAYKIYKD- 88 
270281817 79 IIAVPAFIIYRMVRER 94 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap